go
/
text
зеркало из https://github.com/golang/text.git
1
0
Форкнуть 0
Код Задачи Пакеты Проекты Релизы Вики Активность
text/language/tables.go

3042 строки
120 KiB
Go
Исходник Обычный вид История

text/internal/gen: factored out common generation code. I love go generate, but as it doesn't take command line flags, it is now hard to select a local mirror without manually fiddling with commands. Also, over time, all gen and maketable commands have gotten slightly different command lines and local mirror structures. This change cleans this up and makes it much easier to build tables. Change-Id: I9d61f72447f43c45d52e1b5c2e3a6de7735687d4 Reviewed-on: https://go-review.googlesource.com/6591 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-03 16:02:25 +03:00
// This file was generated by go generate; DO NOT EDIT
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
go.text/language: renaming of locale package: - renamed package locale to language - renamed type ID to Tag (language.Tag) - renamed type Language to Base (language.Base) - deleting locale package - changed occurences of "locale identifier" in comments to "language tag". - renamed method variable names from id or loc to t when the receiver type is Tag. R=r, nigeltao CC=golang-dev https://golang.org/cl/13468043
2013-09-05 13:16:24 +04:00
package language
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
internal/tag: factored out tag.Index tag.Index will also be used by currency and possibly other packages. gen now also writes types (if there is no stutter) for vars and const. This allows strings to be of a specific type. index data in language is now written as consts. No performance impact was measured. Change-Id: I1b63a5bc5e54264acd825000df5af67f8ae759a6 Reviewed-on: https://go-review.googlesource.com/13922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-26 14:28:13 +03:00
import "golang.org/x/text/internal/tag"
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
// CLDRVersion is the CLDR version from which the tables in this package are derived.
const CLDRVersion = "27.0.1"
go.text/language: added Converage interface as a generic mechanism to report supported tags and coverage levels. This interface will be used by packages in go.text to indicate their coverage. This CL also includes a fix in maketables.go to prepare for CLDR 25. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/77760044
2014-03-20 14:35:29 +04:00
// Version is the version of CLDR used to generate the data in this package.
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
//
// Deprecated: use CLDRVersion
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
const Version = "27.0.1"
go.text/language: added Parent() method that returns the CLDR parent of a tag. Also added tie-breaker rule to Matcher to prefer matches for which there is a parent relation over those where this is not the case. Note that this is a low-priority rule as the region distance is a better measure (close regions are likely to share the same parent; this is not true for English, but this is already special-cased in a different manner). Also script and region equality are stronger measures than the parent relationship. The Parent relationship may change between different versions of CLDR (albeit usually only slightly). Added a Version constant to identify CLDR version on which the package is based. LGTM=r R=r CC=golang-codereviews, markdavis https://golang.org/cl/74210044
2014-03-12 10:51:42 +04:00
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
const numLanguages = 8632
go.text/language: added Converage interface as a generic mechanism to report supported tags and coverage levels. This interface will be used by packages in go.text to indicate their coverage. This CL also includes a fix in maketables.go to prepare for CLDR 25. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/77760044
2014-03-20 14:35:29 +04:00
text/language: updated tables with fresh IANA data. Change-Id: I7807c1f28528a946f124b97a136b0dbd352deba5 Reviewed-on: https://go-review.googlesource.com/6922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-05 18:50:15 +03:00
const numScripts = 223
go.text/language: added Converage interface as a generic mechanism to report supported tags and coverage levels. This interface will be used by packages in go.text to indicate their coverage. This CL also includes a fix in maketables.go to prepare for CLDR 25. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/77760044
2014-03-20 14:35:29 +04:00
const numRegions = 354
language: added Currencies to the Coverage type. This is the first in a series of currency-related CLs. Currencies have been not fully supported until now as I wasn't sure whether to put them in a separate package or included them here. There are several reasons to take the approach as originally envisoned: 1) Currencies are somewhat looser, but still quite coupled with the other types in Region. 2) It would be quite a small package on its own. 3) It allows piggybacking on existing types like Coverage. 4) There are not many other types that we can expect to add (the set of locale-related types has been quite steady in other systems). 5) Currencies is usually included in locale-related functionality in other libraries. 6) We would have to deal with some circular dependencies. 7) Moving Currency out is not backward compatible. The main problem with keeping Currency is that language.Currency is somewhat ugly. By hindsight, locale might still have been a better name for this package. It is consistent with language.Region and language.Script, though. Change-Id: If7c4ebf5ca014881fe5866eaa9e132babdf0c2f6 Reviewed-on: https://go-review.googlesource.com/11637 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-06-29 20:45:23 +03:00
const numCurrencies = 296
go.text/language: canonicalize deprecated regions and scripts. Analoguous to deprecated languages, deprecated regions are represented with their own internal codes and get canonicalized when necessary. The deprecated regions were previously not recognized. - refactored code for writing sorted maps. - refactored region testing code in separate components to simplify tests. - CLDR does not include the deprecated 3-letter ISO codes for all deprecated codes. We added them for completeness. - Script deprecation is hard-coded. The CLDR data only contains one remapping. maketables.go checks that this is indeed the only one. This adds about 250 bytes of data. R=r CC=golang-dev https://golang.org/cl/19850043
2013-11-08 15:52:05 +04:00
type fromTo struct {
from uint16
to uint16
}
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
const nonCanonicalUnd = 634
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
const (
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
_af = 10
_am = 16
_ar = 20
_az = 34
_bg = 54
_bn = 72
_ca = 94
_cs = 118
_da = 125
_de = 130
_el = 150
_en = 151
_es = 153
_et = 155
_fa = 160
_fi = 164
_fil = 165
_fr = 170
_gu = 205
_he = 217
_hi = 218
_hr = 230
_hu = 234
_hy = 235
_id = 240
_is = 250
_it = 251
_ja = 255
_ka = 264
_kk = 294
_km = 298
_kn = 300
_ko = 301
_ky = 324
_lo = 348
_lt = 352
_lv = 359
_mk = 387
_ml = 388
_mn = 389
_mo = 392
_mr = 396
_ms = 400
_mul = 404
_my = 411
_nb = 420
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
_ne = 426
_nl = 435
_no = 439
_pa = 460
_pl = 476
_pt = 484
_ro = 504
_ru = 508
_sh = 537
_si = 540
_sk = 542
_sl = 544
_sq = 557
_sr = 558
_sv = 570
_sw = 571
_ta = 579
_te = 586
_th = 591
_tl = 602
_tn = 605
_tr = 609
_uk = 631
_ur = 637
_uz = 638
_vi = 643
_zh = 690
_zu = 692
_jbo = 6819
_ami = 1015
_bnn = 1722
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
_hak = 214
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
_tlh = 13832
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
_lb = 331
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
_nv = 448
_pwn = 11420
_tao = 13553
_tay = 13563
_tsu = 14027
_nn = 437
_sfb = 12994
_vgt = 15066
_sgg = 13025
_cmn = 2372
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
_nan = 417
_hsn = 232
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
)
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
const langPrivateStart = 0x2cf7
go.text/locale: Expanded API and fixed bug: - Exposed functions for parsing Language, Script, Region and Currency. - Exposed several of the internal methods for these types as well. - Fixed bug where not all private use tags were registered due to a bug in inc. R=r CC=golang-dev https://golang.org/cl/12987043
2013-08-16 14:13:35 +04:00
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
const langPrivateEnd = 0x2efe
go.text/locale: Expanded API and fixed bug: - Exposed functions for parsing Language, Script, Region and Currency. - Exposed several of the internal methods for these types as well. - Fixed bug where not all private use tags were registered due to a bug in inc. R=r CC=golang-dev https://golang.org/cl/12987043
2013-08-16 14:13:35 +04:00
go.text/language: renaming of locale package: - renamed package locale to language - renamed type ID to Tag (language.Tag) - renamed type Language to Base (language.Base) - deleting locale package - changed occurences of "locale identifier" in comments to "language tag". - renamed method variable names from id or loc to t when the receiver type is Tag. R=r, nigeltao CC=golang-dev https://golang.org/cl/13468043
2013-09-05 13:16:24 +04:00
// lang holds an alphabetically sorted list of ISO-639 language identifiers.
// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// For 2-byte language identifiers, the two successive bytes have the following meaning:
// - if the first letter of the 2- and 3-letter ISO codes are the same:
// the second and third letter of the 3-letter ISO code.
// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
// For 3-byte language identifiers the 4th byte is 0.
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
// Size: 2784 bytes
internal/tag: factored out tag.Index tag.Index will also be used by currency and possibly other packages. gen now also writes types (if there is no stutter) for vars and const. This allows strings to be of a specific type. index data in language is now written as consts. No performance impact was measured. Change-Id: I1b63a5bc5e54264acd825000df5af67f8ae759a6 Reviewed-on: https://go-review.googlesource.com/13922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-26 14:28:13 +03:00
const lang tag.Index = "" +
gen: factored out some code generation code Created new CodeWriter type that wraps a buffer and keeps track of some whitespacing, taking some of the tediousness away. Goal: - simplify writing upcoming localization packages - take out some common code - make output look consistent Change-Id: I46dc25bdb48d0be52ff84f80f2e55b019ed53cd3 Reviewed-on: https://go-review.googlesource.com/13668 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-19 22:13:15 +03:00
"---\x00aaarabbkabr\x00ace\x00ach\x00ada\x00ady\x00aeveaeb\x00affragq\x00" +
"akkaakk\x00aln\x00alt\x00ammhamo\x00anrgaoz\x00arraarc\x00arn\x00aro\x00" +
"arq\x00ary\x00arz\x00assmasa\x00ast\x00atj\x00avvaawa\x00ayymazzeazb\x00" +
"baakbal\x00ban\x00bap\x00bar\x00bas\x00bax\x00bbc\x00bbj\x00bci\x00beelb" +
"em\x00bew\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgx\x00bhihbh" +
"b\x00bhi\x00bhk\x00bho\x00biisbik\x00bin\x00bjj\x00bjn\x00bkm\x00bku\x00" +
"blt\x00bmambmq\x00bnenboodbpy\x00bqi\x00bqv\x00brrebra\x00brh\x00brx\x00" +
"bsosbsq\x00bss\x00bto\x00btv\x00bua\x00buc\x00bug\x00bum\x00bvb\x00byn" +
"\x00byv\x00bze\x00caatcch\x00ccp\x00ceheceb\x00cgg\x00chhachk\x00chm\x00" +
"cho\x00chp\x00chr\x00cja\x00cjm\x00ckb\x00cooscop\x00cps\x00crrecrj\x00c" +
"rk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandak" +
"\x00dar\x00dav\x00dcc\x00deeuden\x00dgr\x00dje\x00dnj\x00doi\x00dsb\x00d" +
"tm\x00dtp\x00dua\x00dvivdyo\x00dyu\x00dzzoebu\x00eeweefi\x00egl\x00egy" +
"\x00eky\x00elllenngeopoes\x00\x05esu\x00etstett\x00euusewo\x00ext\x00faa" +
"sfan\x00ffulffm\x00fiinfil\x00fit\x00fjijfoaofon\x00frrafrc\x00frp\x00fr" +
"r\x00frs\x00fud\x00fuq\x00fur\x00fuv\x00fyrygalegaa\x00gag\x00gan\x00gay" +
"\x00gbm\x00gbz\x00gcr\x00gdlagez\x00ggn\x00gil\x00gjk\x00gju\x00gllgglk" +
"\x00gnrngom\x00gon\x00gor\x00gos\x00got\x00grc\x00grt\x00gsw\x00guujgub" +
"\x00guc\x00gur\x00guz\x00gvlvgvr\x00gwi\x00haauhak\x00haw\x00haz\x00heeb" +
"hiinhif\x00hil\x00hmd\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homohoc\x00h" +
"oj\x00hrrvhsb\x00hsn\x00htathuunhyyehzerianaiba\x00ibb\x00idndieleigboii" +
"iiikpkikt\x00ilo\x00inndinh\x00iodoisslittaiukuiw\x00\x03izh\x00japnjam" +
"\x00jgo\x00ji\x00\x06jmc\x00jml\x00jut\x00jvavjwavkaatkaa\x00kab\x00kac" +
"\x00kaj\x00kam\x00kao\x00kbd\x00kcg\x00kck\x00kde\x00kdt\x00kea\x00ken" +
"\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgp\x00kha\x00khb\x00khn\x00khq\x00k" +
"ht\x00khw\x00kiikkiu\x00kjuakjg\x00kkazkkj\x00klalkln\x00kmhmkmb\x00knan" +
"koorkoi\x00kok\x00kos\x00kpe\x00kraukrc\x00kri\x00krj\x00krl\x00kru\x00k" +
"sasksb\x00ksf\x00ksh\x00kuurkum\x00kvomkvr\x00kvx\x00kw\x00\x01kxm\x00kx" +
"p\x00kyirlaatlab\x00lad\x00lag\x00lah\x00laj\x00lbtzlbe\x00lbw\x00lcp" +
"\x00lep\x00lez\x00lgugliimlif\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lmn" +
"\x00lmo\x00lninloaolol\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy" +
"\x00luz\x00lvavlwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00m" +
"an\x00mas\x00maz\x00mdf\x00mdh\x00mdr\x00men\x00mer\x00mfa\x00mfe\x00mgl" +
"gmgh\x00mgo\x00mgp\x00mgy\x00mhahmirimin\x00mis\x00mkkdmlalmnonmni\x00mn" +
"w\x00moolmoe\x00moh\x00mos\x00mrarmrd\x00mrj\x00mru\x00mssamtltmtr\x00mu" +
"a\x00mul\x00mus\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00myyamyv\x00myx\x00" +
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
"myz\x00mzn\x00naaunan\x00nap\x00naq\x00nbobnch\x00nci\x00nddendc\x00nds" +
"\x00neepnew\x00ngdongl\x00nhe\x00nhw\x00nij\x00niu\x00njo\x00nlldnmg\x00" +
"nnnonnh\x00noornod\x00noe\x00non\x00nqo\x00nrblnsk\x00nso\x00nus\x00nvav" +
"nxq\x00nyyanym\x00nyn\x00nzi\x00occiojjiomrmorriosssotk\x00paanpag\x00pa" +
"l\x00pam\x00pap\x00pau\x00pcd\x00pcm\x00pdc\x00pdt\x00peo\x00pfl\x00phn" +
"\x00pilipka\x00pko\x00plolpms\x00pnt\x00pon\x00pra\x00prd\x00prg\x00psus" +
"ptorpuu\x00quuequc\x00qug\x00raj\x00rcf\x00rej\x00rgn\x00ria\x00rif\x00r" +
"js\x00rkt\x00rmohrmf\x00rmo\x00rmt\x00rmu\x00rnunrng\x00roonrob\x00rof" +
"\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00ryu\x00saansaf\x00sah\x00s" +
"aq\x00sas\x00sat\x00saz\x00sbp\x00scrdsck\x00scn\x00sco\x00scs\x00sdndsd" +
"c\x00semesef\x00seh\x00sei\x00ses\x00sgagsga\x00sgs\x00sh\x00\x02shi\x00" +
"shn\x00siinsid\x00sklkskr\x00sllvsli\x00sly\x00smmosma\x00smj\x00smn\x00" +
"smp\x00sms\x00snnasnk\x00soomsou\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00" +
"ssswssy\x00stotstq\x00suunsuk\x00sus\x00svweswwaswb\x00swc\x00swv\x00sxn" +
"\x00syl\x00syr\x00szl\x00taamtaj\x00tbw\x00tcy\x00tdd\x00tdg\x00tdh\x00t" +
"eeltem\x00teo\x00tet\x00tggkthhathl\x00thq\x00thr\x00tiirtig\x00tiv\x00t" +
"kuktkl\x00tkr\x00tkt\x00tlgltly\x00tmh\x00tnsntoontog\x00tpi\x00trurtru" +
"\x00trv\x00tssotsd\x00tsf\x00tsg\x00tsj\x00ttatttj\x00tts\x00ttt\x00tum" +
"\x00tvl\x00twwitwq\x00tyahtyv\x00tzm\x00udm\x00ugiguga\x00ukkruli\x00umb" +
"\x00und\x00unr\x00unx\x00urrduzzbvai\x00veenvec\x00vep\x00viievic\x00vls" +
"\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00walnwae\x00wal\x00war\x00wbp" +
"\x00wbq\x00wbr\x00wls\x00woolwtm\x00wuu\x00xav\x00xcr\x00xhhoxlc\x00xld" +
"\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00xog\x00xpr\x00xsa\x00xsr\x00yao" +
"\x00yap\x00yav\x00ybb\x00yiidyooryrl\x00yua\x00zahazbl\x00zdj\x00zea\x00" +
"zgh\x00zhhozmi\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
const langNoIndexOffset = 695
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
// in lookup tables. The language ids for these language codes are derived directly
// from the letters and are not consecutive.
// Size: 2197 bytes, 2197 elements
var langNoIndex = [2197]uint8{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 0 - 3F
0xff, 0xfd, 0xfd, 0xfe, 0xef, 0xf7, 0xbf, 0xd2,
0xfb, 0xbf, 0xfe, 0xfa, 0xb7, 0x1d, 0x3c, 0x57,
0x6f, 0x97, 0x73, 0xf8, 0xff, 0xef, 0xff, 0x70,
0xbf, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x85, 0x62,
0xe9, 0xbf, 0xfd, 0xff, 0xff, 0xf7, 0xfd, 0x77,
0xbf, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xe3,
0xc9, 0xff, 0xff, 0xff, 0x4d, 0xb8, 0x0a, 0x6a,
0x7e, 0xfa, 0xe3, 0xff, 0x7e, 0xff, 0x77, 0xff,
// Entry 40 - 7F
0xff, 0xff, 0xff, 0xdf, 0x2b, 0xf4, 0xf1, 0xe0,
0x5d, 0xe7, 0x9f, 0x14, 0x07, 0x20, 0xdf, 0xed,
0x9f, 0x37, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0xf7,
0x7e, 0xff, 0xff, 0xff, 0xfe, 0x7f, 0xff, 0xff,
0xff, 0xff, 0x7f, 0xfc, 0xdb, 0xfd, 0xbf, 0xb5,
0x7b, 0xff, 0x7f, 0xf7, 0xeb, 0xfe, 0xff, 0xa7,
0xbd, 0xff, 0x7f, 0xf7, 0xff, 0xef, 0xef, 0xef,
0xff, 0xff, 0x9f, 0xff, 0xff, 0xef, 0xff, 0xdf,
// Entry 80 - BF
0xff, 0xff, 0xf3, 0xff, 0xfb, 0x2f, 0xff, 0xff,
0xfb, 0xee, 0xff, 0xbd, 0xdb, 0xff, 0xdf, 0xf7,
0xff, 0xfa, 0xfd, 0xff, 0x7e, 0xaf, 0x7b, 0xfe,
0x7f, 0xff, 0xff, 0xfe, 0xff, 0xff, 0xdf, 0xff,
0xff, 0xdf, 0xfb, 0xff, 0xfd, 0xfc, 0xfb, 0xff,
0xff, 0xff, 0xff, 0xf7, 0x7f, 0xbf, 0xfd, 0xd5,
0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
0x08, 0x24, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
// Entry C0 - FF
0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
0x9b, 0x14, 0x88, 0xf6, 0x7b, 0xe7, 0x17, 0x56,
0x55, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
0xbc, 0x87, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
0x40, 0x00, 0x40, 0x92, 0x21, 0xd0, 0xbf, 0x5d,
// Entry 100 - 13F
0xfd, 0xde, 0xfe, 0x5e, 0x00, 0x00, 0x02, 0x64,
0x8d, 0x19, 0xc1, 0xdf, 0x79, 0x22, 0x00, 0x00,
0x00, 0xdf, 0x6d, 0xdc, 0x26, 0xe5, 0xd9, 0xf3,
0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
0x56, 0x89, 0x5e, 0xb7, 0xec, 0xef, 0x03, 0x00,
0x02, 0x00, 0x00, 0x00, 0xc0, 0x77, 0xda, 0x57,
0x90, 0x69, 0x01, 0x2c, 0x16, 0x79, 0xe4, 0xff,
// Entry 140 - 17F
0xff, 0x7f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x46,
0x00, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x16,
0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
0x00, 0x00, 0x50, 0xd5, 0x2d, 0x00, 0x64, 0x35,
0x24, 0x53, 0xf5, 0xd4, 0xbd, 0xe2, 0xcd, 0x03,
// Entry 180 - 1BF
0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
0x00, 0x04, 0x17, 0x39, 0x01, 0xd9, 0x57, 0x98,
0x21, 0x98, 0xa5, 0x00, 0x00, 0x01, 0x40, 0x82,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0xb0, 0xfe,
0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x40,
0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
// Entry 1C0 - 1FF
0x10, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
0x04, 0x20, 0x04, 0xa6, 0x08, 0x04, 0x00, 0x08,
0x01, 0x50, 0x00, 0x00, 0x08, 0x11, 0x86, 0x40,
0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x06, 0x55,
0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x60,
0x3b, 0x83, 0x11, 0x00, 0x80, 0x00, 0x11, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0xbe, 0xdf, 0xff, 0xfe, 0xbf,
// Entry 200 - 23F
0xdf, 0xc7, 0x83, 0x82, 0xc0, 0xff, 0xdf, 0x27,
0xcf, 0x5f, 0xe7, 0x01, 0x10, 0x20, 0xb2, 0xc5,
0xa4, 0x45, 0x25, 0x9b, 0x03, 0xcf, 0xf0, 0xdf,
0x03, 0xc4, 0x00, 0x10, 0x01, 0x0e, 0x01, 0xe3,
0x92, 0x54, 0xdb, 0x38, 0xf1, 0x7f, 0xf7, 0x6d,
0xf9, 0xff, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
0x21, 0x12, 0x6c, 0x5f, 0xdd, 0x0f, 0x85, 0x4f,
0x40, 0x40, 0x00, 0x04, 0xf9, 0xfd, 0xfd, 0xd4,
// Entry 240 - 27F
0xe8, 0x13, 0xf4, 0x27, 0xa3, 0x0d, 0x00, 0x00,
0x20, 0x7b, 0x39, 0x02, 0x05, 0x84, 0x00, 0xf0,
0xbf, 0x7f, 0xda, 0x00, 0x18, 0x04, 0x81, 0x00,
0x00, 0x00, 0x80, 0x10, 0x94, 0x1c, 0x01, 0x00,
0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
0x08, 0xb4, 0x7c, 0xa5, 0x0c, 0x40, 0x00, 0x00,
0x11, 0x04, 0x04, 0x6c, 0x00, 0x60, 0x70, 0xff,
0xfb, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x6e,
// Entry 280 - 2BF
0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
0xe2, 0xff, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
0x08, 0x00, 0x00, 0x00, 0x00, 0xa1, 0x02, 0x60,
0xe5, 0x48, 0x14, 0x89, 0x20, 0xc0, 0x47, 0x80,
0x07, 0x00, 0x00, 0x00, 0xcc, 0x50, 0x40, 0x24,
0x85, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
// Entry 2C0 - 2FF
0x02, 0x50, 0x88, 0x11, 0x00, 0xd1, 0x6c, 0xee,
0x50, 0x03, 0x1d, 0x11, 0x69, 0x06, 0x59, 0xe9,
0x33, 0x08, 0x00, 0x20, 0x05, 0x40, 0x10, 0x00,
0x00, 0x00, 0x50, 0x44, 0x96, 0x49, 0xd6, 0x5d,
0xa7, 0x81, 0x45, 0x97, 0xfb, 0x00, 0x10, 0x00,
0x08, 0x00, 0x80, 0x00, 0x40, 0x45, 0x00, 0x01,
0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x04, 0x08,
0xf8, 0xeb, 0xf6, 0x39, 0xc4, 0x99, 0x16, 0x00,
// Entry 300 - 33F
0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa2,
0x01, 0x00, 0x00, 0x00, 0x12, 0x04, 0x00, 0x00,
0x04, 0x10, 0xf0, 0x9d, 0x95, 0x13, 0x04, 0x80,
0x00, 0x00, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x0a, 0x00,
0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0xc0,
0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
// Entry 340 - 37F
0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
0x00, 0x10, 0x00, 0x00, 0x00, 0xf8, 0x85, 0xe3,
0xdd, 0xff, 0xff, 0xff, 0xbb, 0xff, 0x7f, 0xfb,
0xff, 0xfc, 0xfe, 0xdf, 0xff, 0xff, 0xff, 0xf6,
0xfb, 0xfe, 0xf7, 0x1f, 0xff, 0xb3, 0xed, 0xff,
0xdb, 0xed, 0xff, 0xfe, 0xff, 0xfe, 0xdf, 0xff,
0xff, 0xff, 0xf7, 0xff, 0xfd, 0xff, 0xff, 0xff,
0xfd, 0xff, 0xdf, 0xaf, 0x9c, 0xff, 0xfb, 0xff,
// Entry 380 - 3BF
0xff, 0xff, 0xff, 0xff, 0xef, 0xd2, 0xbb, 0xdf,
0xf5, 0xff, 0xff, 0xff, 0xff, 0xff, 0xfe, 0xef,
0xfd, 0xff, 0xff, 0xf7, 0xfd, 0xff, 0xff, 0xff,
0xef, 0xdb, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
0xff, 0x5f, 0xd3, 0x7b, 0xfd, 0xd9, 0xdf, 0xef,
0xbc, 0x18, 0x05, 0x2c, 0xff, 0x07, 0xf0, 0xff,
0xf7, 0x5f, 0x00, 0x08, 0x00, 0xc3, 0x3d, 0x1b,
0x06, 0xe6, 0x72, 0xf0, 0xdd, 0x3c, 0x7f, 0x44,
// Entry 3C0 - 3FF
0x02, 0x30, 0x9f, 0x7a, 0x16, 0xfd, 0xff, 0x57,
0xf2, 0xff, 0x39, 0xff, 0xf2, 0x1e, 0x95, 0xf7,
0xf7, 0xff, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
0x84, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
0xf9, 0xfd, 0xfe, 0xff, 0xff, 0xff, 0xff, 0xff,
// Entry 400 - 43F
0xd7, 0x6f, 0xff, 0xff, 0xdf, 0x7d, 0xbb, 0xff,
0xff, 0xff, 0xf7, 0xf3, 0xef, 0xff, 0xff, 0xf7,
0xff, 0xdf, 0xdb, 0x77, 0xff, 0xff, 0x7f, 0xff,
0xff, 0xff, 0xef, 0xff, 0xbd, 0xff, 0xff, 0xfb,
0xff, 0xfb, 0xff, 0xde, 0x76, 0xbd, 0xff, 0xf7,
0xff, 0xff, 0xf7, 0xff, 0xff, 0xdf, 0xf3, 0xbf,
0xef, 0xff, 0xff, 0xff, 0xff, 0x7f, 0x7f, 0xde,
0xf7, 0xbb, 0xef, 0xf7, 0xff, 0xfb, 0xbf, 0xdf,
// Entry 440 - 47F
0xfd, 0xfe, 0xff, 0xff, 0xfe, 0xff, 0x5f, 0x7d,
0x7f, 0xff, 0xff, 0xff, 0xe5, 0xfc, 0xff, 0xfd,
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x7f, 0x7f, 0xfe, 0x9e, 0xae, 0xff, 0xee, 0xff,
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
0x7f, 0xf7, 0x7b, 0x02, 0x82, 0x04, 0xff, 0xf7,
0xff, 0xbf, 0xd7, 0xef, 0xfe, 0xdf, 0xf7, 0xfe,
0xe2, 0x8e, 0xe7, 0xff, 0xf7, 0xff, 0x56, 0xbd,
0xcd, 0xff, 0xfb, 0xff, 0xff, 0xdf, 0xef, 0xff,
0xe5, 0xdf, 0x7d, 0x0f, 0xa7, 0x51, 0x04, 0x44,
// Entry 480 - 4BF
0x13, 0xd0, 0x5d, 0xaf, 0xa6, 0xfd, 0xb9, 0xff,
0x43, 0x5d, 0x5b, 0xff, 0xff, 0xbf, 0x3f, 0x20,
0x14, 0x00, 0x57, 0x51, 0x82, 0x65, 0xf5, 0x49,
0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
0x00, 0x51, 0x60, 0x05, 0x04, 0x01, 0x00, 0x00,
0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
// Entry 4C0 - 4FF
0xfd, 0x67, 0x4b, 0x06, 0x95, 0x02, 0x57, 0xed,
0xfb, 0x4c, 0x9d, 0x7b, 0x83, 0x04, 0x62, 0x40,
0x00, 0x15, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
0xf9, 0x5f, 0x10, 0x8c, 0xc9, 0x46, 0xde, 0xf7,
0x13, 0x31, 0x00, 0x00, 0x00, 0x00, 0x00, 0x90,
0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
0x01, 0x40, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x7d,
0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
// Entry 500 - 53F
0xb0, 0xff, 0x79, 0x7a, 0x04, 0x00, 0x00, 0x49,
0x2d, 0x14, 0x25, 0x77, 0xed, 0xf1, 0xbf, 0xef,
0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xfc,
0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xf5, 0xff,
0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7f, 0x10,
0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
0x5f, 0x05, 0x86, 0xef, 0xf5, 0x77, 0xbd, 0x3c,
0x00, 0x00, 0x00, 0x43, 0x71, 0x42, 0x00, 0x40,
// Entry 540 - 57F
0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
// Entry 580 - 5BF
0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
0x00, 0x00, 0x00, 0x00, 0xf0, 0xde, 0xff, 0xbf,
0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
0x00, 0x30, 0x95, 0xe3, 0x10, 0x00, 0x00, 0x00,
0x11, 0x04, 0x16, 0x00, 0x01, 0x02, 0x00, 0x81,
0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
// Entry 5C0 - 5FF
0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x7e, 0x02,
0xaa, 0x10, 0x5d, 0xd8, 0x52, 0x00, 0x80, 0x20,
0x00, 0x00, 0x00, 0x00, 0x40, 0x10, 0x02, 0x02,
0x09, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
0x31, 0x00, 0x00, 0x00, 0x01, 0x50, 0x02, 0x20,
0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x00, 0x00,
0x00, 0x1f, 0xdf, 0xf2, 0xfd, 0xff, 0xfd, 0x3f,
0x9f, 0x18, 0xcf, 0xbc, 0xbf, 0xaf, 0x5f, 0xfe,
// Entry 600 - 63F
0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xfd,
0xb7, 0xf7, 0xff, 0xf3, 0xdf, 0xff, 0x6f, 0xf1,
0x7b, 0xf1, 0x7f, 0xdf, 0x7f, 0xbf, 0xfe, 0xb7,
0xee, 0x1d, 0xfb, 0xdb, 0xef, 0xdf, 0xff, 0xfd,
0x7e, 0xbe, 0x57, 0xff, 0x6f, 0x81, 0x76, 0x1f,
0xd4, 0x77, 0xf5, 0xfd, 0xff, 0xff, 0xeb, 0xfe,
0xbf, 0x5f, 0x57, 0x1b, 0xeb, 0x5f, 0x50, 0x18,
0x02, 0xfe, 0xff, 0x9d, 0x15, 0x97, 0x15, 0x0f,
// Entry 640 - 67F
0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0xd7, 0x7e,
0xff, 0xff, 0xff, 0xef, 0xff, 0xfd, 0xdd, 0xde,
0xbc, 0xfd, 0xf6, 0x5f, 0x7a, 0x1f, 0x40, 0x98,
0x02, 0xff, 0xe3, 0xff, 0xf3, 0xd6, 0xf2, 0xff,
0xfb, 0xdf, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
0xf5, 0xbe, 0xff, 0xff, 0xf3, 0xf7, 0xff, 0xf7,
0x7f, 0xff, 0xff, 0xbe, 0xdb, 0xf7, 0xd7, 0xf9,
0xef, 0x2f, 0x80, 0xbf, 0xc5, 0xff, 0xff, 0xf3,
// Entry 680 - 6BF
0x97, 0x9d, 0xff, 0xff, 0xf7, 0xcf, 0xfd, 0xbf,
0xde, 0x7f, 0x06, 0x1d, 0x57, 0xff, 0xf8, 0xda,
0x5d, 0xcf, 0x7d, 0x16, 0xb9, 0xea, 0x69, 0xa0,
0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x48,
0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
0x04, 0x00, 0x10, 0x8c, 0x58, 0xd5, 0x0d, 0x0f,
// Entry 6C0 - 6FF
0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
0x00, 0xdc, 0xff, 0xeb, 0x1f, 0x58, 0x08, 0x41,
0x04, 0xa0, 0x04, 0x00, 0x30, 0x12, 0x40, 0x22,
0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xaf,
0x6f, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
// Entry 700 - 73F
0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
0x80, 0x86, 0xc2, 0x02, 0x00, 0x00, 0x00, 0x01,
0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
0x00, 0x81, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
// Entry 740 - 77F
0x00, 0x00, 0x00, 0xef, 0xf7, 0xfd, 0xcf, 0x7e,
0xa0, 0x11, 0x10, 0x00, 0x00, 0x92, 0x01, 0x44,
0xcd, 0xf9, 0x5e, 0x00, 0x01, 0x00, 0x30, 0x14,
0x04, 0x55, 0x10, 0x01, 0x04, 0xf6, 0x3f, 0x7a,
0x05, 0x04, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
0x97, 0x7c, 0x9f, 0x71, 0xcc, 0x78, 0xd5, 0x43,
0xf5, 0x57, 0x67, 0x14, 0x01, 0x00, 0x00, 0x00,
0x00, 0x00, 0x2c, 0xf7, 0xdb, 0x1f, 0x50, 0x60,
// Entry 780 - 7BF
0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0xaa, 0x01,
0x00, 0x00, 0x30, 0x00, 0x24, 0x44, 0x00, 0x00,
0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
0xb5, 0xff, 0xd5, 0xd7, 0xbc, 0x70, 0xd6, 0x78,
0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xe9, 0x41,
0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
0xff, 0xef, 0xff, 0x4f, 0x85, 0x53, 0xf4, 0xed,
// Entry 7C0 - 7FF
0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xf5, 0x42,
0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0xc0, 0x56,
0xcc, 0x16, 0x9e, 0xfb, 0x35, 0x7d, 0xef, 0xff,
0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x5d,
0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
0x10, 0x20, 0x24, 0x00, 0xff, 0x3f, 0xdf, 0x67,
0xfe, 0x01, 0x06, 0x88, 0x0a, 0x40, 0x16, 0x01,
0x01, 0x15, 0x2b, 0x3e, 0x01, 0x00, 0x00, 0x10,
// Entry 800 - 83F
0x90, 0x69, 0x45, 0x02, 0x02, 0x01, 0xe1, 0xbf,
0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa7, 0xd1,
0x54, 0x9e, 0x44, 0xdf, 0xfd, 0x8f, 0x66, 0xb3,
0x55, 0x20, 0xd4, 0xc3, 0xd8, 0x30, 0x3d, 0x80,
0x00, 0x00, 0x00, 0x4c, 0xd4, 0x10, 0xc5, 0x84,
0x6e, 0x50, 0x00, 0x22, 0x50, 0x7e, 0xbf, 0xdb,
0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
// Entry 840 - 87F
0xf0, 0xff, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
0x84, 0x00, 0x33, 0xc0, 0x23, 0x24, 0x00, 0x00,
0x00, 0xcb, 0xe4, 0x3a, 0x42, 0xc8, 0x14, 0xf1,
0xef, 0xff, 0x7f, 0x16, 0x01, 0x01, 0x84, 0x50,
0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
// Entry 880 - 8BF
0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
0x0a, 0x00, 0x80, 0x00, 0x00,
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
}
// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
// to 2-letter language codes that cannot be derived using the method described above.
// Each 3-letter code is followed by its 1-byte langID.
internal/tag: factored out tag.Index tag.Index will also be used by currency and possibly other packages. gen now also writes types (if there is no stutter) for vars and const. This allows strings to be of a specific type. index data in language is now written as consts. No performance impact was measured. Change-Id: I1b63a5bc5e54264acd825000df5af67f8ae759a6 Reviewed-on: https://go-review.googlesource.com/13922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-26 14:28:13 +03:00
// Size: 32 bytes
const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
// Size: 12 bytes, 6 elements
var altLangIndex = [6]uint16{
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x0141, 0x0219, 0x00fd, 0x01ff, 0x0099, 0x0102,
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
}
text/language: upgraded to CLDR 26. - CLDR 26 introduced a new type of legacy language alias from ISO-639. Instead of having three different tables of language replacements, there is now just one where each entry is marked with a replacement type. - Moved to using go generate. - Introduced code file shared by maketables and package to make the use of constants a bit more manageable. Expect more to move there over time. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/166640043
2014-11-19 15:06:59 +03:00
// langAliasMap maps langIDs to their suggested replacements.
text/language: updated tables with fresh IANA data. Change-Id: I7807c1f28528a946f124b97a136b0dbd352deba5 Reviewed-on: https://go-review.googlesource.com/6922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-05 18:50:15 +03:00
// Size: 556 bytes, 139 elements
var langAliasMap = [139]fromTo{
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{from: 0xf7, to: 0xf0},
{from: 0xfd, to: 0xd9},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{from: 0x102, to: 0x2a9},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{from: 0x107, to: 0x106},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{from: 0x188, to: 0x1f8},
{from: 0x1a4, to: 0x1b7},
{from: 0x219, to: 0x22e},
{from: 0x25a, to: 0xa5},
{from: 0x266, to: 0x244},
{from: 0x26f, to: 0xc},
{from: 0x2c3, to: 0x2c9},
{from: 0x314, to: 0x8f},
{from: 0x3b5, to: 0x1c36},
{from: 0x3d6, to: 0x22d},
{from: 0x3e7, to: 0x22d},
{from: 0x472, to: 0x14},
{from: 0x47d, to: 0xeb},
{from: 0x4c3, to: 0x1f26},
{from: 0x538, to: 0x21},
{from: 0x53e, to: 0x2720},
{from: 0x54a, to: 0x22},
{from: 0x56b, to: 0x9d},
{from: 0x591, to: 0x25},
{from: 0x59a, to: 0x3f},
{from: 0x648, to: 0xc68},
{from: 0x774, to: 0x19b},
{from: 0x7bb, to: 0x165},
{from: 0x7c2, to: 0x56},
{from: 0x843, to: 0x30a7},
{from: 0x8bd, to: 0x2b2},
{from: 0x8fa, to: 0x23df},
{from: 0x903, to: 0x948},
{from: 0x920, to: 0x241},
{from: 0x941, to: 0x3fae},
{from: 0x944, to: 0x2b2},
{from: 0xa3e, to: 0x70},
{from: 0xa8d, to: 0x76},
{from: 0xb4d, to: 0x87},
{from: 0xb5c, to: 0x198},
{from: 0xb7d, to: 0xb80},
{from: 0xb83, to: 0x2b6},
{from: 0xc64, to: 0x1ddf},
{from: 0xc73, to: 0x2c1f},
{from: 0xcbe, to: 0x1b3},
{from: 0xe55, to: 0x9b},
{from: 0xe89, to: 0x170},
{from: 0xf25, to: 0xf4},
{from: 0xffe, to: 0xc},
{from: 0x11a9, to: 0xaa},
{from: 0x11f5, to: 0xa2},
{from: 0x12a4, to: 0xb20},
{from: 0x12a8, to: 0x1c8},
{from: 0x12b7, to: 0x144a},
{from: 0x1305, to: 0x108},
{from: 0x1308, to: 0x82},
{from: 0x1328, to: 0x3a34},
{from: 0x13ef, to: 0xc6},
{from: 0x144d, to: 0x96},
{from: 0x1485, to: 0x277d},
{from: 0x149d, to: 0xc4},
{from: 0x14ff, to: 0x12a9},
{from: 0x158e, to: 0x153b},
{from: 0x159b, to: 0x1678},
{from: 0x160f, to: 0x232},
{from: 0x16fe, to: 0x1a86},
{from: 0x17f9, to: 0x2935},
{from: 0x180f, to: 0xfa},
{from: 0x18df, to: 0xfc},
{from: 0x190b, to: 0x129a},
{from: 0x1dc2, to: 0x1e62},
{from: 0x1ddf, to: 0x185},
{from: 0x1e68, to: 0x13c},
{from: 0x1e73, to: 0x132},
{from: 0x1e77, to: 0x119},
{from: 0x1e7e, to: 0x12f},
{from: 0x1e94, to: 0x1f70},
{from: 0x1eba, to: 0x13e},
{from: 0x1f6b, to: 0x4223},
{from: 0x1f79, to: 0x3708},
{from: 0x1fe7, to: 0x6af},
{from: 0x209b, to: 0x2fab},
{from: 0x2107, to: 0x30ea},
{from: 0x21f7, to: 0x167},
{from: 0x2269, to: 0x183},
{from: 0x2275, to: 0x180},
{from: 0x227f, to: 0x190},
{from: 0x22d5, to: 0x8e0},
{from: 0x232e, to: 0x66},
{from: 0x23c3, to: 0x170},
{from: 0x244e, to: 0x2439},
{from: 0x247e, to: 0x1e9},
{from: 0x24ac, to: 0x3a34},
{from: 0x24ea, to: 0x2439},
{from: 0x2674, to: 0x25bc},
{from: 0x2699, to: 0x1aa},
{from: 0x289f, to: 0x1c7},
{from: 0x2981, to: 0x1c9},
{from: 0x29c4, to: 0x3a34},
{from: 0x2a81, to: 0x1e3},
{from: 0x2a98, to: 0x31c},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{from: 0x2acc, to: 0xa0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{from: 0x2acd, to: 0xa0},
{from: 0x2b84, to: 0x17a},
{from: 0x2b9f, to: 0x2b1a},
{from: 0x2ba6, to: 0x149},
{from: 0x2bea, to: 0x2007},
{from: 0x2c74, to: 0x2c5c},
{from: 0x2f18, to: 0x1e6},
{from: 0x30eb, to: 0x3113},
{from: 0x31af, to: 0x1f8},
{from: 0x3273, to: 0x1655},
{from: 0x336b, to: 0x21e},
{from: 0x33dd, to: 0x129},
{from: 0x33fb, to: 0x20a},
{from: 0x3482, to: 0x23b},
{from: 0x35b0, to: 0x2a20},
{from: 0x35b4, to: 0x49},
{from: 0x35b7, to: 0x2fad},
{from: 0x35f1, to: 0x372b},
{from: 0x3617, to: 0x3d45},
{from: 0x363a, to: 0x2c1f},
{from: 0x36e1, to: 0x25c},
{from: 0x38d3, to: 0xb16},
{from: 0x38fd, to: 0xe7f},
{from: 0x3a1e, to: 0x27e},
{from: 0x3d42, to: 0x7c},
{from: 0x4043, to: 0x2f8},
{from: 0x40fd, to: 0x131},
{from: 0x4150, to: 0x3450},
{from: 0x4152, to: 0x83},
{from: 0x4234, to: 0x30a7},
{from: 0x4268, to: 0x2a9},
{from: 0x434f, to: 0x218e},
{from: 0x4362, to: 0x2461},
{from: 0x4395, to: 0x4633},
{from: 0x4433, to: 0x4425},
{from: 0x44c3, to: 0x44ca},
{from: 0x469b, to: 0x190},
{from: 0x472c, to: 0x2ad},
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
}
text/language: updated tables with fresh IANA data. Change-Id: I7807c1f28528a946f124b97a136b0dbd352deba5 Reviewed-on: https://go-review.googlesource.com/6922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-05 18:50:15 +03:00
// Size: 139 bytes, 139 elements
var langAliasTypes = [139]langAliasType{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 0 - 3F
0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, 1, 1,
2, 0, 1, 0, 1, 2, 1, 1, 0, 2, 1, 1, 0, 2, 0, 0,
1, 0, 1, 1, 2, 1, 1, 1, 1, 0, 0, 2, 1, 1, 1, 1,
2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, 1, 1, 1, 1, 1,
// Entry 40 - 7F
0, 0, 2, 1, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 1,
0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 1, 1,
1, 0, 1, 0, 2, 1, 1, 0, 1, 0, 0, 1, 1, 2, 0, 2,
1, 1, 1, 0, 2, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, 1,
// Entry 80 - BF
0, 1, 0, 1, 0, 0, 0, 0, 1, 1, 1,
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
}
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
const (
text/language: updated tables with fresh IANA data. Change-Id: I7807c1f28528a946f124b97a136b0dbd352deba5 Reviewed-on: https://go-review.googlesource.com/6922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-05 18:50:15 +03:00
_Latn = 79
_Hani = 48
_Hans = 50
_Hant = 51
_Qaaa = 125
_Qaai = 133
_Qabx = 174
_Zinh = 218
_Zyyy = 222
_Zzzz = 223
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
)
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// script is an alphabetically sorted list of ISO 15924 codes. The index
go.text/language: renaming of locale package: - renamed package locale to language - renamed type ID to Tag (language.Tag) - renamed type Language to Base (language.Base) - deleting locale package - changed occurences of "locale identifier" in comments to "language tag". - renamed method variable names from id or loc to t when the receiver type is Tag. R=r, nigeltao CC=golang-dev https://golang.org/cl/13468043
2013-09-05 13:16:24 +04:00
// of the script in the string, divided by 4, is the internal scriptID.
internal/tag: factored out tag.Index tag.Index will also be used by currency and possibly other packages. gen now also writes types (if there is no stutter) for vars and const. This allows strings to be of a specific type. index data in language is now written as consts. No performance impact was measured. Change-Id: I1b63a5bc5e54264acd825000df5af67f8ae759a6 Reviewed-on: https://go-review.googlesource.com/13922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-26 14:28:13 +03:00
// Size: 900 bytes
const script tag.Index = "" +
gen: factored out some code generation code Created new CodeWriter type that wraps a buffer and keeps track of some whitespacing, taking some of the tediousness away. Goal: - simplify writing upcoming localization packages - take out some common code - make output look consistent Change-Id: I46dc25bdb48d0be52ff84f80f2e55b019ed53cd3 Reviewed-on: https://go-review.googlesource.com/13668 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-19 22:13:15 +03:00
"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBlisBopoBrah" +
"BraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDsrtDuplEgydEgyh" +
"EgypElbaEthiGeokGeorGlagGothGranGrekGujrGuruHangHaniHanoHansHantHatrHebr" +
"HiraHluwHmngHrktHungIndsItalJavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKnda" +
"KoreKpelKthiLanaLaooLatfLatgLatnLepcLimbLinaLinbLisuLomaLyciLydiMahjMand" +
"ManiMarcMayaMendMercMeroMlymModiMongMoonMrooMteiMultMymrNarbNbatNkgbNkoo" +
"NshuOgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPlrdPrtiQaaa" +
"QaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaas" +
"QaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabk" +
"QablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSara" +
"SarbSaurSgnwShawShrdSiddSindSinhSoraSundSyloSyrcSyreSyrjSyrnTagbTakrTale" +
"TaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWoleXpeo" +
"XsuxYiiiZinhZmthZsymZxxxZyyyZzzz\xff\xff\xff\xff"
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// suppressScript is an index from langID to the dominant script for that language,
// if it exists. If a script is given, it should be suppressed from the language tag.
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
// Size: 695 bytes, 695 elements
var suppressScript = [695]uint8{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 0 - 3F
0x00, 0x00, 0x1d, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00,
0x26, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1d, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1d, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
// Entry 40 - 7F
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4f, 0x00,
0x00, 0x00, 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4f, 0x00,
0x00, 0x00, 0x00, 0x00, 0x4f, 0x4f, 0x00, 0x00,
// Entry 80 - BF
0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00,
0x4f, 0x00, 0x00, 0x00, 0xce, 0x00, 0x00, 0xd0,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x4f,
0x4f, 0x4f, 0x00, 0x4f, 0x00, 0x4f, 0x00, 0x00,
0x05, 0x00, 0x00, 0x00, 0x4f, 0x00, 0x00, 0x4f,
0x4f, 0x00, 0x4f, 0x00, 0x00, 0x4f, 0x4f, 0x00,
0x00, 0x00, 0x00, 0x4f, 0x4f, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
// Entry C0 - FF
0x00, 0x00, 0x4f, 0x00, 0x4f, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x4f, 0x2d, 0x00, 0x00,
0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x35, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4f, 0x4f,
0x00, 0x4f, 0x4f, 0x08, 0x00, 0x00, 0x00, 0x00,
0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4f,
0x00, 0x00, 0x4f, 0x4f, 0x00, 0x35, 0x00, 0x3e,
// Entry 100 - 13F
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x28, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1d, 0x00,
0x4f, 0x00, 0x43, 0x00, 0x47, 0x48, 0x00, 0x1f,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
// Entry 140 - 17F
0x00, 0x00, 0x00, 0x00, 0x00, 0x4f, 0x00, 0x00,
0x00, 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x4f, 0x4c, 0x00, 0x00, 0x00,
0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4f,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4f, 0x00,
0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x4f,
// Entry 180 - 1BF
0x00, 0x00, 0x00, 0x1d, 0x60, 0x00, 0x00, 0x00,
0x4f, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00, 0x00,
0x4f, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x67, 0x00, 0x00, 0x00, 0x00,
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x4f, 0x00, 0x00, 0x00, 0x4f, 0x00, 0x00, 0x4f,
0x00, 0x4f, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x4f, 0x00, 0x4f, 0x00, 0x4f, 0x00, 0x4f,
0x00, 0x00, 0x00, 0x6b, 0x4f, 0x00, 0x4f, 0x00,
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 1C0 - 1FF
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00,
0x4f, 0x70, 0x00, 0x00, 0x2e, 0x00, 0x00, 0x00,
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x00, 0x00, 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x05, 0x4f, 0x00, 0x4f, 0x00,
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x4f, 0x00,
0x4f, 0x00, 0x00, 0x00, 0x1d, 0x00, 0x00, 0x4f,
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 200 - 23F
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4f, 0x00,
0x00, 0x00, 0x00, 0x00, 0xbb, 0x00, 0x4f, 0x00,
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
0x4f, 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00,
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x00, 0x00, 0x00, 0x4f, 0x00, 0x4f, 0x00, 0x00,
0x00, 0x00, 0x00, 0x4f, 0x00, 0x4f, 0x00, 0x00,
0x00, 0x00, 0x4f, 0x4f, 0x00, 0x00, 0x00, 0x00,
// Entry 240 - 27F
0x00, 0x00, 0x00, 0xc7, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0xca, 0x4f, 0x00, 0x00, 0x00, 0xcf,
0x00, 0x00, 0x00, 0x26, 0x00, 0x00, 0x00, 0x4f,
0x00, 0x00, 0x4f, 0x00, 0x4f, 0x4f, 0x4f, 0x00,
0x4f, 0x4f, 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4f, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1d,
0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00,
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 280 - 2BF
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x4f, 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00,
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
0x00, 0x35, 0x00, 0x00, 0x00, 0x00, 0x0f, 0x00,
0x00, 0x00, 0x00, 0x00, 0x4f, 0x00, 0x00,
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
}
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
const (
go.text/language: added predefined common tag values. The benefits of using predefined tags are: - convenience for the user - an additional layer or indirection for tag representations that may change in the future (e.g. pt to mean Brazilian Portuguese or just Portuguese). Predefined values are only provided for a selection of tags. The selection is based on CLDR data and augmented with languages for populous areas where speakers do not typically also fluently speak a language that was already included in the set (thereby increasing the likelihood of needing it) and languages for which tags may be ambiguous. We do not intend to provide similar constants for Regions, Scripts and Base values. Specifically the set of Regions is much more "dynamic" than the set of languages. The (Tag|Base|Script|Region|Currency)OrDie methods are provided as a convenience for the user to specify values at startup. Details: - Went with names instead of codes to allow for a level of indirection on top of tags. - Names for the tags are taken from CLDR for the en locale. - Internal tag constants are now prefixed with '_' instead of lang_, reg, scr and cur. All tags are unique between these for so this does not pose a problem. It makes the predefined values for tags look a lot better in the godocs. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/59740047
2014-02-18 15:38:45 +04:00
_001 = 1
_419 = 30
_BR = 64
_CA = 72
_ES = 109
_GB = 121
_MD = 186
_PT = 236
go.text/language: added TLD method to get the ccTLD equivalent of a region. - Added Region.Canonicalize to make its use more practical in some cases. This is generally a useful operation and is warranted as a shortcut for converting to a Tag, canonicalizing and converting back. - Added regionTypes lookup table to quickly determine if a region is a valid ccTLD. This table takes less space than the equivalent code needed to compute this from existing data. It also allows for other space and time optimizations for other routine. - Added Region.IsGroup method as a counterpart to IsCountry. - Cleaned up meaning of IsPrivateUse. Now is strictly private use as defined by BCP 47 and ISO. Internal mappings are ignored but can be detected using IsCountry or IsGroup. - Moved splitting of IANA registry ranges to registry parsing time. - For maketables, always print source URL in comment, not the local copy. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/144820043
2014-09-19 20:19:18 +04:00
_UK = 304
go.text/language: added predefined common tag values. The benefits of using predefined tags are: - convenience for the user - an additional layer or indirection for tag representations that may change in the future (e.g. pt to mean Brazilian Portuguese or just Portuguese). Predefined values are only provided for a selection of tags. The selection is based on CLDR data and augmented with languages for populous areas where speakers do not typically also fluently speak a language that was already included in the set (thereby increasing the likelihood of needing it) and languages for which tags may be ambiguous. We do not intend to provide similar constants for Regions, Scripts and Base values. Specifically the set of Regions is much more "dynamic" than the set of languages. The (Tag|Base|Script|Region|Currency)OrDie methods are provided as a convenience for the user to specify values at startup. Details: - Went with names instead of codes to allow for a level of indirection on top of tags. - Names for the tags are taken from CLDR for the en locale. - Internal tag constants are now prefixed with '_' instead of lang_, reg, scr and cur. All tags are unique between these for so this does not pose a problem. It makes the predefined values for tags look a lot better in the godocs. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/59740047
2014-02-18 15:38:45 +04:00
_US = 306
_ZZ = 354
_XA = 320
_XC = 322
go.text/cldr: Upgraded cldr, display, and language package to CLDR 25. collatation is tricky and will be handled in a different CL. display: - Minor naming updates. language: - Added support for the provisional tag for Kosovo (XK). - Hani script is no longer a special case. Removed respective code. - Likely tags now make specialize a group region to a single country. This requires a new table for group regions. - addTags now specializes region groups whenever it can make an unambiguous choice. - Matching changed format. maketables now supports both. - Added Contains method to Region for determining wheter a region is contained by another. Do later: - Cash rounding and decimals for currencies. LGTM=r R=r CC=golang-codereviews, nigeltao https://golang.org/cl/102120044
2014-06-04 12:35:00 +04:00
_XK = 330
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
)
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
// the UN.M49 codes used for groups.)
go.text/locale: some semantics and API changes - Defined 0 value to be "unspecified" id for languages, scripts and regions. These values are not directly exposed to the user, but rather are used to distinguish between the case where the user explicitly specifies, for example, Zzzz vs not specifying it. - The nil-value for ID now identifies Root. - Use Zyyy (undetermined) instead of Zzzz (uncoded, as used by CLDR) as the code for an unspecified script. CLDR uses Zzzz, but BCP47 prescribes using Zyyy in this case. With the new semantics is choice is somewhat arbitrary, so we stick with BCP47. - Added error to Canonicalize to accommodate future canonicalization algorithms. - Removed Parent and Written as their semantics are rather hazy. - Added Confidence to Language method as well. - Removed Scope methods. Instead, user should just filter pre-defined lists of IDs to mimic its functionality. - Added SetTypeForKey and removed KeyValueString. The same can be done with the former, but is much easier to use for the common case (change the type for a single key on an existing ID). - Removed SimplifyOptions as it is unclear such functionality should be exposed to the user or that it belongs in ID at all. Implemented: - Language, Script, Region - IsCountry R=r CC=golang-dev https://golang.org/cl/10697043
2013-07-08 23:10:26 +04:00
const isoRegionOffset = 31
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
go.text/language: added TLD method to get the ccTLD equivalent of a region. - Added Region.Canonicalize to make its use more practical in some cases. This is generally a useful operation and is warranted as a shortcut for converting to a Tag, canonicalizing and converting back. - Added regionTypes lookup table to quickly determine if a region is a valid ccTLD. This table takes less space than the equivalent code needed to compute this from existing data. It also allows for other space and time optimizations for other routine. - Added Region.IsGroup method as a counterpart to IsCountry. - Cleaned up meaning of IsPrivateUse. Now is strictly private use as defined by BCP 47 and ISO. Internal mappings are ignored but can be detected using IsCountry or IsGroup. - Moved splitting of IANA registry ranges to registry parsing time. - For maketables, always print source URL in comment, not the local copy. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/144820043
2014-09-19 20:19:18 +04:00
// regionTypes defines the status of a region for various standards.
// Size: 355 bytes, 355 elements
var regionTypes = [355]uint8{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 0 - 3F
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
// Entry 40 - 7F
0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, 0x00,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
// Entry 80 - BF
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
// Entry C0 - FF
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06,
0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06,
0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06,
0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
// Entry 100 - 13F
0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
0x02, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
// Entry 140 - 17F
0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
0x05, 0x05, 0x04, 0x06, 0x06, 0x04, 0x06, 0x06,
0x04, 0x06, 0x05,
go.text/language: added TLD method to get the ccTLD equivalent of a region. - Added Region.Canonicalize to make its use more practical in some cases. This is generally a useful operation and is warranted as a shortcut for converting to a Tag, canonicalizing and converting back. - Added regionTypes lookup table to quickly determine if a region is a valid ccTLD. This table takes less space than the equivalent code needed to compute this from existing data. It also allows for other space and time optimizations for other routine. - Added Region.IsGroup method as a counterpart to IsCountry. - Cleaned up meaning of IsPrivateUse. Now is strictly private use as defined by BCP 47 and ISO. Internal mappings are ignored but can be detected using IsCountry or IsGroup. - Moved splitting of IANA registry ranges to registry parsing time. - For maketables, always print source URL in comment, not the local copy. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/144820043
2014-09-19 20:19:18 +04:00
}
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
// Each 2-letter codes is followed by two bytes with the following meaning:
// - [A-Z}{2}: the first letter of the 2-letter code plus these two
// letters form the 3-letter ISO code.
// - 0, n: index into altRegionISO3.
internal/tag: factored out tag.Index tag.Index will also be used by currency and possibly other packages. gen now also writes types (if there is no stutter) for vars and const. This allows strings to be of a specific type. index data in language is now written as consts. No performance impact was measured. Change-Id: I1b63a5bc5e54264acd825000df5af67f8ae759a6 Reviewed-on: https://go-review.googlesource.com/13922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-26 14:28:13 +03:00
// Size: 1300 bytes
const regionISO tag.Index = "" +
gen: factored out some code generation code Created new CodeWriter type that wraps a buffer and keeps track of some whitespacing, taking some of the tediousness away. Goal: - simplify writing upcoming localization packages - take out some common code - make output look consistent Change-Id: I46dc25bdb48d0be52ff84f80f2e55b019ed53cd3 Reviewed-on: https://go-review.googlesource.com/13668 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-19 22:13:15 +03:00
"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
"HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03FIINFJJIFKLKFMSMFOROFQ" +
"\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGRRC" +
"GS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSRIM" +
"MNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00\x09" +
"KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTULUUX" +
"LVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQMRRT" +
"MSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOORNPPL" +
"NQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00\x12" +
"PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTTQU" +
"\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYCSD" +
"DNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYRSZ" +
"WZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTVUV" +
"TWWNTZZAUAKRUGGAUK UMMIUSSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVUUTWFLF" +
"WKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXOOOXPPP" +
"XQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAFZMMBZR" +
"ARZWWEZZZZ\xff\xff\xff\xff"
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// altRegionISO3 holds a list of 3-letter region codes that cannot be
// mapped to 2-letter codes using the default algorithm. This is a short list.
internal/tag: factored out tag.Index tag.Index will also be used by currency and possibly other packages. gen now also writes types (if there is no stutter) for vars and const. This allows strings to be of a specific type. index data in language is now written as consts. No performance impact was measured. Change-Id: I1b63a5bc5e54264acd825000df5af67f8ae759a6 Reviewed-on: https://go-review.googlesource.com/13922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-26 14:28:13 +03:00
// Size: 33 bytes
const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
// altRegionIDs holds a list of regionIDs the positions of which match those
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// of the 3-letter ISO codes in altRegionISO3.
go.text/language: canonicalize deprecated regions and scripts. Analoguous to deprecated languages, deprecated regions are represented with their own internal codes and get canonicalized when necessary. The deprecated regions were previously not recognized. - refactored code for writing sorted maps. - refactored region testing code in separate components to simplify tests. - CLDR does not include the deprecated 3-letter ISO codes for all deprecated codes. We added them for completeness. - Script deprecation is hard-coded. The CLDR data only contains one remapping. maketables.go checks that this is indeed the only one. This adds about 250 bytes of data. R=r CC=golang-dev https://golang.org/cl/19850043
2013-11-08 15:52:05 +04:00
// Size: 22 bytes, 11 elements
var altRegionIDs = [11]uint16{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
0x0056, 0x006f, 0x0086, 0x00a6, 0x00a8, 0x00ab, 0x00e8, 0x0103,
0x011f, 0x015c, 0x00da,
go.text/language: canonicalize deprecated regions and scripts. Analoguous to deprecated languages, deprecated regions are represented with their own internal codes and get canonicalized when necessary. The deprecated regions were previously not recognized. - refactored code for writing sorted maps. - refactored region testing code in separate components to simplify tests. - CLDR does not include the deprecated 3-letter ISO codes for all deprecated codes. We added them for completeness. - Script deprecation is hard-coded. The CLDR data only contains one remapping. maketables.go checks that this is indeed the only one. This adds about 250 bytes of data. R=r CC=golang-dev https://golang.org/cl/19850043
2013-11-08 15:52:05 +04:00
}
// Size: 80 bytes, 20 elements
var regionOldMap = [20]fromTo{
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{from: 0x43, to: 0xc2},
{from: 0x57, to: 0xa5},
{from: 0x5e, to: 0x5f},
{from: 0x65, to: 0x3a},
{from: 0x77, to: 0x76},
{from: 0x91, to: 0x36},
{from: 0xa1, to: 0x131},
{from: 0xbf, to: 0x131},
{from: 0xd5, to: 0x13c},
{from: 0xda, to: 0x2a},
{from: 0xed, to: 0x131},
{from: 0xf0, to: 0xe0},
{from: 0xfa, to: 0x6f},
{from: 0x101, to: 0x161},
{from: 0x128, to: 0x124},
{from: 0x130, to: 0x79},
{from: 0x137, to: 0x13b},
{from: 0x13e, to: 0x131},
{from: 0x15a, to: 0x15b},
{from: 0x160, to: 0x4a},
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
}
// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
// codes indicating collections of regions.
go.text/language: canonicalize deprecated regions and scripts. Analoguous to deprecated languages, deprecated regions are represented with their own internal codes and get canonicalized when necessary. The deprecated regions were previously not recognized. - refactored code for writing sorted maps. - refactored region testing code in separate components to simplify tests. - CLDR does not include the deprecated 3-letter ISO codes for all deprecated codes. We added them for completeness. - Script deprecation is hard-coded. The CLDR data only contains one remapping. maketables.go checks that this is indeed the only one. This adds about 250 bytes of data. R=r CC=golang-dev https://golang.org/cl/19850043
2013-11-08 15:52:05 +04:00
// Size: 710 bytes, 355 elements
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
var m49 = [355]int16{
// Entry 0 - 3F
0, 1, 2, 3, 5, 9, 11, 13,
14, 15, 17, 18, 19, 21, 29, 30,
34, 35, 39, 53, 54, 57, 61, 142,
143, 145, 150, 151, 154, 155, 419, 958,
0, 20, 784, 4, 28, 660, 8, 51,
530, 24, 10, 32, 16, 40, 36, 533,
248, 31, 70, 52, 50, 56, 854, 100,
48, 108, 204, 652, 60, 96, 68, 535,
// Entry 40 - 7F
76, 44, 64, 104, 74, 72, 112, 84,
124, 166, 180, 140, 178, 756, 384, 184,
152, 120, 156, 170, 0, 188, 891, 296,
192, 132, 531, 162, 196, 203, 278, 276,
0, 262, 208, 212, 214, 204, 12, 0,
218, 233, 818, 732, 232, 724, 231, 967,
246, 242, 238, 583, 234, 0, 250, 249,
266, 826, 308, 268, 254, 831, 288, 292,
// Entry 80 - BF
304, 270, 324, 312, 226, 300, 239, 320,
316, 624, 328, 344, 334, 340, 191, 332,
348, 854, 0, 360, 372, 376, 833, 356,
86, 368, 364, 352, 380, 832, 388, 400,
392, 581, 404, 417, 116, 296, 174, 659,
408, 410, 414, 136, 398, 418, 422, 662,
438, 144, 430, 426, 440, 442, 428, 434,
504, 492, 498, 499, 663, 450, 584, 581,
// Entry C0 - FF
807, 466, 104, 496, 446, 580, 474, 478,
500, 470, 480, 462, 454, 484, 458, 508,
516, 540, 562, 574, 566, 548, 558, 528,
578, 524, 10, 520, 536, 570, 554, 512,
591, 0, 604, 258, 598, 608, 586, 616,
666, 612, 630, 275, 620, 581, 585, 600,
591, 634, 959, 960, 961, 962, 963, 964,
965, 966, 967, 968, 969, 970, 971, 972,
// Entry 100 - 13F
638, 716, 642, 688, 643, 646, 682, 90,
690, 729, 752, 702, 654, 705, 744, 703,
694, 674, 686, 706, 740, 728, 678, 810,
222, 534, 760, 748, 0, 796, 148, 260,
768, 764, 762, 772, 626, 795, 788, 776,
626, 792, 780, 798, 158, 834, 804, 800,
826, 581, 840, 858, 860, 336, 670, 704,
862, 92, 850, 704, 548, 876, 581, 882,
// Entry 140 - 17F
973, 974, 975, 976, 977, 978, 979, 980,
981, 982, 983, 984, 985, 986, 987, 988,
989, 990, 991, 992, 993, 994, 995, 996,
997, 998, 720, 887, 175, 891, 710, 894,
180, 716, 999,
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
}
go.text/language: added a seperate table for mapping from UN.M49 to region code. It turned out that the mapping is a bit more complex than simply using a single table, with the following features: - blocks of sorted array of UN.M49 and region pairs. - each block is indexed by the 3 msb of the 10-bit UN.M49 code. - each block contains a sorted list of uint16s where the 7 msb are the 7 lsb of the UN.M49 code and the 9 lsb are the region code. - total table size increase is 582 bytes A more straightforward approach would have lead to a table size of at least 1K, up to 2k. However, the lookup code for these approaches is either not substantially smaller or the table size is notably larger. The table also includes a few more new entries from the IANA registry. R=r CC=golang-codereviews https://golang.org/cl/44560043
2013-12-23 12:34:53 +04:00
// m49Index gives indexes into fromM49 based on the three most significant bits
// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
// The region code is stored in the 9 lsb of the indexed value.
// Size: 18 bytes, 9 elements
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
var m49Index = [9]int16{
0, 59, 107, 142, 180, 219, 258, 290,
332,
go.text/language: added a seperate table for mapping from UN.M49 to region code. It turned out that the mapping is a bit more complex than simply using a single table, with the following features: - blocks of sorted array of UN.M49 and region pairs. - each block is indexed by the 3 msb of the 10-bit UN.M49 code. - each block contains a sorted list of uint16s where the 7 msb are the 7 lsb of the UN.M49 code and the 9 lsb are the region code. - total table size increase is 582 bytes A more straightforward approach would have lead to a table size of at least 1K, up to 2k. However, the lookup code for these approaches is either not substantially smaller or the table size is notably larger. The table also includes a few more new entries from the IANA registry. R=r CC=golang-codereviews https://golang.org/cl/44560043
2013-12-23 12:34:53 +04:00
}
// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
// Size: 664 bytes, 332 elements
var fromM49 = [332]uint16{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 0 - 3F
0x0201, 0x0402, 0x0603, 0x0823, 0x0a04, 0x1026, 0x1205, 0x142a,
0x1606, 0x1866, 0x1a07, 0x1c08, 0x1e09, 0x202c, 0x220a, 0x240b,
0x260c, 0x2821, 0x2a0d, 0x3029, 0x3824, 0x3a0e, 0x3c0f, 0x3e31,
0x402b, 0x4410, 0x4611, 0x482e, 0x4e12, 0x502d, 0x5841, 0x6038,
0x6434, 0x6627, 0x6833, 0x6a13, 0x6c14, 0x7035, 0x7215, 0x783c,
0x7a16, 0x8042, 0x883e, 0x8c32, 0x9045, 0x9444, 0x9840, 0xa847,
0xac98, 0xb507, 0xb939, 0xc03d, 0xc837, 0xd0c2, 0xd839, 0xe046,
0xe8a4, 0xf051, 0xf848, 0x0859, 0x10ab, 0x184b, 0x1c17, 0x1e18,
// Entry 40 - 7F
0x20b1, 0x2219, 0x291e, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d,
0x3852, 0x3d2c, 0x445b, 0x4c49, 0x5453, 0x5ca6, 0x5f5c, 0x644c,
0x684a, 0x704f, 0x7855, 0x7e8e, 0x8058, 0x885c, 0x965d, 0x983a,
0xa062, 0xa863, 0xac64, 0xb468, 0xbd18, 0xc484, 0xcc6e, 0xce6e,
0xd06c, 0xd269, 0xd474, 0xdc72, 0xde86, 0xe471, 0xec70, 0xf030,
0xf277, 0xf476, 0xfc7c, 0x04e3, 0x091f, 0x0c61, 0x1478, 0x187b,
0x1c81, 0x26eb, 0x285f, 0x2c5e, 0x305f, 0x407e, 0x487f, 0x50a5,
0x5885, 0x6080, 0x687a, 0x7083, 0x7888, 0x8087, 0x8882, 0x908a,
// Entry 80 - BF
0x988f, 0x9c8c, 0xa135, 0xa88d, 0xb08b, 0xb890, 0xc09b, 0xc897,
0xd093, 0xd89a, 0xe099, 0xe894, 0xf095, 0xf89c, 0x004e, 0x089e,
0x10a0, 0x1cac, 0x209f, 0x28a2, 0x30a8, 0x34a9, 0x3caa, 0x42a3,
0x44ad, 0x461e, 0x4cae, 0x54b3, 0x58b6, 0x5cb2, 0x64b7, 0x6cb0,
0x70b4, 0x74b5, 0x7cc4, 0x84bd, 0x8ccc, 0x94ce, 0x9ccb, 0xa4c1,
0xacc9, 0xb4c6, 0xbcc7, 0xc0ca, 0xc8cd, 0xd8b9, 0xe0c3, 0xe4ba,
0xe6bb, 0xe8c8, 0xf0b8, 0xf8cf, 0x00df, 0x08d0, 0x10db, 0x18d9,
0x20d7, 0x2428, 0x265a, 0x2a2f, 0x2d19, 0x2e3f, 0x30dc, 0x38d1,
// Entry C0 - FF
0x493c, 0x54de, 0x5cd6, 0x64d2, 0x6cd4, 0x74dd, 0x7cd3, 0x84d8,
0x88c5, 0x8b31, 0x8e73, 0x90be, 0x92ee, 0x94e6, 0x9ee0, 0xace4,
0xb0ef, 0xb8e2, 0xc0e5, 0xc8e9, 0xd0e7, 0xd8ec, 0xe089, 0xe524,
0xecea, 0xf4f1, 0xfd00, 0x0502, 0x0704, 0x0d05, 0x183b, 0x1d0c,
0x26a7, 0x2825, 0x2caf, 0x2ebc, 0x34e8, 0x3d36, 0x4511, 0x4d16,
0x5506, 0x5d12, 0x6103, 0x6508, 0x6d10, 0x7d0b, 0x7f0f, 0x813b,
0x830d, 0x8513, 0x8d5e, 0x9961, 0xa15a, 0xa86d, 0xb115, 0xb309,
0xb86b, 0xc109, 0xc914, 0xd10e, 0xd91b, 0xe10a, 0xe84d, 0xf11a,
// Entry 100 - 13F
0xf522, 0xf921, 0x0120, 0x0923, 0x1127, 0x192a, 0x2022, 0x2926,
0x3129, 0x3725, 0x391d, 0x3d2b, 0x412f, 0x492e, 0x4ec0, 0x5517,
0x646a, 0x7479, 0x7e7d, 0x809d, 0x8296, 0x852d, 0x9132, 0xa53a,
0xac36, 0xb533, 0xb934, 0xbd38, 0xd93d, 0xe53f, 0xed5b, 0xef5b,
0xf656, 0xfd5f, 0x7c1f, 0x7ef2, 0x80f3, 0x82f4, 0x84f5, 0x86f6,
0x88f7, 0x8af8, 0x8cf9, 0x8e6f, 0x90fb, 0x92fc, 0x94fd, 0x96fe,
0x98ff, 0x9b40, 0x9d41, 0x9f42, 0xa143, 0xa344, 0xa545, 0xa746,
0xa947, 0xab48, 0xad49, 0xaf4a, 0xb14b, 0xb34c, 0xb54d, 0xb74e,
// Entry 140 - 17F
0xb94f, 0xbb50, 0xbd51, 0xbf52, 0xc153, 0xc354, 0xc555, 0xc756,
0xc957, 0xcb58, 0xcd59, 0xcf62,
go.text/language: added a seperate table for mapping from UN.M49 to region code. It turned out that the mapping is a bit more complex than simply using a single table, with the following features: - blocks of sorted array of UN.M49 and region pairs. - each block is indexed by the 3 msb of the 10-bit UN.M49 code. - each block contains a sorted list of uint16s where the 7 msb are the 7 lsb of the UN.M49 code and the 9 lsb are the region code. - total table size increase is 582 bytes A more straightforward approach would have lead to a table size of at least 1K, up to 2k. However, the lookup code for these approaches is either not substantially smaller or the table size is notably larger. The table also includes a few more new entries from the IANA registry. R=r CC=golang-codereviews https://golang.org/cl/44560043
2013-12-23 12:34:53 +04:00
}
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
// Size: 1311 bytes
go.text/language: added proper handling of variants. The package now recognizes valid variants and rejects invalid ones. It accepts variants only if they follow the proper language or proper prefix sequence, as lined out in the BCP 47 spec. If variants are not in the right order, it will make an attempt to sort create a correct sorting order out of them. Duplicate variants are removed. Note that BCP 47 presumes that a script is suppressed if it is marked as such for a language, whereas we allow such scripts to still exist. There is an additional check to handle this case. R=r CC=golang-dev https://golang.org/cl/14555043
2013-10-14 18:06:28 +04:00
var variantIndex = map[string]uint8{
"1606nict": 0x0,
"1694acad": 0x1,
"1901": 0x2,
"1959acad": 0x3,
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
"1994": 0x3f,
go.text/language: added proper handling of variants. The package now recognizes valid variants and rejects invalid ones. It accepts variants only if they follow the proper language or proper prefix sequence, as lined out in the BCP 47 spec. If variants are not in the right order, it will make an attempt to sort create a correct sorting order out of them. Duplicate variants are removed. Note that BCP 47 presumes that a script is suppressed if it is marked as such for a language, whereas we allow such scripts to still exist. There is an additional check to handle this case. R=r CC=golang-dev https://golang.org/cl/14555043
2013-10-14 18:06:28 +04:00
"1996": 0x4,
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
"alalc97": 0x41,
go.text/language: added proper handling of variants. The package now recognizes valid variants and rejects invalid ones. It accepts variants only if they follow the proper language or proper prefix sequence, as lined out in the BCP 47 spec. If variants are not in the right order, it will make an attempt to sort create a correct sorting order out of them. Duplicate variants are removed. Note that BCP 47 presumes that a script is suppressed if it is marked as such for a language, whereas we allow such scripts to still exist. There is an additional check to handle this case. R=r CC=golang-dev https://golang.org/cl/14555043
2013-10-14 18:06:28 +04:00
"aluku": 0x5,
"arevela": 0x6,
"arevmda": 0x7,
"baku1926": 0x8,
go.text/language: tweaked language matcher and fixed some anomalies. - No longer takes transitive closure of languageMatch entries. E.g. A Dane will understand Norwegian Bokmål. A writer of Bokmål will undestand Norwegian Nynorsk, but a Dane will typically not understand Nynorsk. - Changed langMatch entries with a percentage of 90 to be High instead of Low. (An arbitrary choice, but seems better.) - Fixed matching of sr-Latn vs sr-Cyrl. - Language-specific script mappings are now supported. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/68190043
2014-02-28 01:29:49 +04:00
"balanka": 0x9,
"barla": 0xa,
"bauddha": 0xb,
"biscayan": 0xc,
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
"biske": 0x3a,
go.text/language: tweaked language matcher and fixed some anomalies. - No longer takes transitive closure of languageMatch entries. E.g. A Dane will understand Norwegian Bokmål. A writer of Bokmål will undestand Norwegian Nynorsk, but a Dane will typically not understand Nynorsk. - Changed langMatch entries with a percentage of 90 to be High instead of Low. (An arbitrary choice, but seems better.) - Fixed matching of sr-Latn vs sr-Cyrl. - Language-specific script mappings are now supported. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/68190043
2014-02-28 01:29:49 +04:00
"bohoric": 0xd,
"boont": 0xe,
"dajnko": 0xf,
"ekavsk": 0x10,
"emodeng": 0x11,
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
"fonipa": 0x42,
"fonupa": 0x43,
"fonxsamp": 0x44,
go.text/language: tweaked language matcher and fixed some anomalies. - No longer takes transitive closure of languageMatch entries. E.g. A Dane will understand Norwegian Bokmål. A writer of Bokmål will undestand Norwegian Nynorsk, but a Dane will typically not understand Nynorsk. - Changed langMatch entries with a percentage of 90 to be High instead of Low. (An arbitrary choice, but seems better.) - Fixed matching of sr-Latn vs sr-Cyrl. - Language-specific script mappings are now supported. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/68190043
2014-02-28 01:29:49 +04:00
"hepburn": 0x12,
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
"heploc": 0x40,
go.text/language: tweaked language matcher and fixed some anomalies. - No longer takes transitive closure of languageMatch entries. E.g. A Dane will understand Norwegian Bokmål. A writer of Bokmål will undestand Norwegian Nynorsk, but a Dane will typically not understand Nynorsk. - Changed langMatch entries with a percentage of 90 to be High instead of Low. (An arbitrary choice, but seems better.) - Fixed matching of sr-Latn vs sr-Cyrl. - Language-specific script mappings are now supported. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/68190043
2014-02-28 01:29:49 +04:00
"hognorsk": 0x13,
"ijekavsk": 0x14,
"itihasa": 0x15,
"jauer": 0x16,
"jyutping": 0x17,
"kkcor": 0x18,
text/language: updated tables with fresh IANA data. Change-Id: I7807c1f28528a946f124b97a136b0dbd352deba5 Reviewed-on: https://go-review.googlesource.com/6922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-05 18:50:15 +03:00
"kociewie": 0x19,
"kscor": 0x1a,
"laukika": 0x1b,
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
"lipaw": 0x3b,
text/language: updated tables with fresh IANA data. Change-Id: I7807c1f28528a946f124b97a136b0dbd352deba5 Reviewed-on: https://go-review.googlesource.com/6922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-05 18:50:15 +03:00
"luna1918": 0x1c,
"metelko": 0x1d,
"monoton": 0x1e,
"ndyuka": 0x1f,
"nedis": 0x20,
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
"njiva": 0x3c,
text/language: updated tables with fresh IANA data. Change-Id: I7807c1f28528a946f124b97a136b0dbd352deba5 Reviewed-on: https://go-review.googlesource.com/6922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-05 18:50:15 +03:00
"nulik": 0x21,
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
"osojs": 0x3d,
"oxendict": 0x22,
"pamaka": 0x23,
"petr1708": 0x24,
"pinyin": 0x25,
"polyton": 0x26,
"puter": 0x27,
"rigik": 0x28,
"rozaj": 0x29,
"rumgr": 0x2a,
"scotland": 0x2b,
"scouse": 0x2c,
"solba": 0x3e,
"sotav": 0x2d,
"surmiran": 0x2e,
"sursilv": 0x2f,
"sutsilv": 0x30,
"tarask": 0x31,
"uccor": 0x32,
"ucrcor": 0x33,
"ulster": 0x34,
"unifon": 0x35,
"vaidika": 0x36,
"valencia": 0x37,
"vallader": 0x38,
"wadegile": 0x39,
go.text/language: added proper handling of variants. The package now recognizes valid variants and rejects invalid ones. It accepts variants only if they follow the proper language or proper prefix sequence, as lined out in the BCP 47 spec. If variants are not in the right order, it will make an attempt to sort create a correct sorting order out of them. Duplicate variants are removed. Note that BCP 47 presumes that a script is suppressed if it is marked as such for a language, whereas we allow such scripts to still exist. There is an additional check to handle this case. R=r CC=golang-dev https://golang.org/cl/14555043
2013-10-14 18:06:28 +04:00
}
// variantNumSpecialized is the number of specialized variants in variants.
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
const variantNumSpecialized = 65
go.text/locale: Expanded API and fixed bug: - Exposed functions for parsing Language, Script, Region and Currency. - Exposed several of the internal methods for these types as well. - Fixed bug where not all private use tags were registered due to a bug in inc. R=r CC=golang-dev https://golang.org/cl/12987043
2013-08-16 14:13:35 +04:00
const (
go.text/cldr: Upgraded cldr, display, and language package to CLDR 25. collatation is tricky and will be handled in a different CL. display: - Minor naming updates. language: - Added support for the provisional tag for Kosovo (XK). - Hani script is no longer a special case. Removed respective code. - Likely tags now make specialize a group region to a single country. This requires a new table for group regions. - addTags now specializes region groups whenever it can make an unambiguous choice. - Matching changed format. maketables now supports both. - Added Contains method to Region for determining wheter a region is contained by another. Do later: - Cash rounding and decimals for currencies. LGTM=r R=r CC=golang-codereviews, nigeltao https://golang.org/cl/102120044
2014-06-04 12:35:00 +04:00
_XTS = 279
_XXX = 281
go.text/locale: Expanded API and fixed bug: - Exposed functions for parsing Language, Script, Region and Currency. - Exposed several of the internal methods for these types as well. - Fixed bug where not all private use tags were registered due to a bug in inc. R=r CC=golang-dev https://golang.org/cl/12987043
2013-08-16 14:13:35 +04:00
)
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// currency holds an alphabetically sorted list of canonical 3-letter currency identifiers.
// Each identifier is followed by a byte of which the 6 most significant bits
// indicated the rounding and the least 2 significant bits indicate the
// number of decimal positions.
internal/tag: factored out tag.Index tag.Index will also be used by currency and possibly other packages. gen now also writes types (if there is no stutter) for vars and const. This allows strings to be of a specific type. index data in language is now written as consts. No performance impact was measured. Change-Id: I1b63a5bc5e54264acd825000df5af67f8ae759a6 Reviewed-on: https://go-review.googlesource.com/13922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-26 14:28:13 +03:00
// Size: 1192 bytes
const currency tag.Index = "" +
gen: factored out some code generation code Created new CodeWriter type that wraps a buffer and keeps track of some whitespacing, taking some of the tediousness away. Goal: - simplify writing upcoming localization packages - take out some common code - make output look consistent Change-Id: I46dc25bdb48d0be52ff84f80f2e55b019ed53cd3 Reviewed-on: https://go-review.googlesource.com/13668 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-19 22:13:15 +03:00
"---\x0aADP\x08AED\x0aAFA\x0aAFN\x08ALK\x0aALL\x08AMD\x08ANG\x0aAOA\x0aAO" +
"K\x0aAON\x0aAOR\x0aARA\x0aARL\x0aARM\x0aARP\x0aARS\x0aATS\x0aAUD\x0aAWG" +
"\x0aAZM\x0aAZN\x0aBAD\x0aBAM\x0aBAN\x0aBBD\x0aBDT\x0aBEC\x0aBEF\x0aBEL" +
"\x0aBGL\x0aBGM\x0aBGN\x0aBGO\x0aBHD\x0bBIF\x08BMD\x0aBND\x0aBOB\x0aBOL" +
"\x0aBOP\x0aBOV\x0aBRB\x0aBRC\x0aBRE\x0aBRL\x0aBRN\x0aBRR\x0aBRZ\x0aBSD" +
"\x0aBTN\x0aBUK\x0aBWP\x0aBYB\x0aBYR\x08BZD\x0aCAD\x0aCDF\x0aCHE\x0aCHF" +
"\x0aCHW\x0aCLE\x0aCLF\x0cCLP\x08CNX\x0aCNY\x0aCOP\x08COU\x0aCRC\x08CSD" +
"\x0aCSK\x0aCUC\x0aCUP\x0aCVE\x0aCYP\x0aCZK\x0aDDM\x0aDEM\x0aDJF\x08DKK" +
"\x0aDOP\x0aDZD\x0aECS\x0aECV\x0aEEK\x0aEGP\x0aERN\x0aESA\x0aESB\x0aESP" +
"\x08ETB\x0aEUR\x0aFIM\x0aFJD\x0aFKP\x0aFRF\x0aGBP\x0aGEK\x0aGEL\x0aGHC" +
"\x0aGHS\x0aGIP\x0aGMD\x0aGNF\x08GNS\x0aGQE\x0aGRD\x0aGTQ\x0aGWE\x0aGWP" +
"\x0aGYD\x08HKD\x0aHNL\x0aHRD\x0aHRK\x0aHTG\x0aHUF\x0aIDR\x08IEP\x0aILP" +
"\x0aILR\x0aILS\x0aINR\x0aIQD\x08IRR\x08ISJ\x0aISK\x08ITL\x08JMD\x0aJOD" +
"\x0bJPY\x08KES\x0aKGS\x0aKHR\x0aKMF\x08KPW\x08KRH\x0aKRO\x0aKRW\x08KWD" +
"\x0bKYD\x0aKZT\x0aLAK\x08LBP\x08LKR\x0aLRD\x0aLSL\x0aLTL\x0aLTT\x0aLUC" +
"\x0aLUF\x08LUL\x0aLVL\x0aLVR\x0aLYD\x0bMAD\x0aMAF\x0aMCF\x0aMDC\x0aMDL" +
"\x0aMGA\x08MGF\x08MKD\x0aMKN\x0aMLF\x0aMMK\x08MNT\x08MOP\x0aMRO\x08MTL" +
"\x0aMTP\x0aMUR\x08MVR\x0aMWK\x0aMXN\x0aMXP\x0aMXV\x0aMYR\x0aMZE\x0aMZM" +
"\x0aMZN\x0aNAD\x0aNGN\x0aNIC\x0aNIO\x0aNLG\x0aNOK\x0aNPR\x0aNZD\x0aOMR" +
"\x0bPAB\x0aPEI\x0aPEN\x0aPES\x0aPGK\x0aPHP\x0aPKR\x08PLN\x0aPLZ\x0aPTE" +
"\x0aPYG\x08QAR\x0aRHD\x0aROL\x0aRON\x0aRSD\x08RUB\x0aRUR\x0aRWF\x08SAR" +
"\x0aSBD\x0aSCR\x0aSDD\x0aSDG\x0aSDP\x0aSEK\x0aSGD\x0aSHP\x0aSIT\x0aSKK" +
"\x0aSLL\x08SOS\x08SRD\x0aSRG\x0aSSP\x0aSTD\x08SUR\x0aSVC\x0aSYP\x08SZL" +
"\x0aTHB\x0aTJR\x0aTJS\x0aTMM\x08TMT\x0aTND\x0bTOP\x0aTPE\x0aTRL\x08TRY" +
"\x0aTTD\x0aTWD\x0aTZS\x08UAH\x0aUAK\x0aUGS\x0aUGX\x08USD\x0aUSN\x0aUSS" +
"\x0aUYI\x08UYP\x0aUYU\x0aUZS\x08VEB\x0aVEF\x0aVND\x08VNN\x0aVUV\x08WST" +
"\x0aXAF\x08XAG\x0aXAU\x0aXBA\x0aXBB\x0aXBC\x0aXBD\x0aXCD\x0aXDR\x0aXEU" +
"\x0aXFO\x0aXFU\x0aXOF\x08XPD\x0aXPF\x08XPT\x0aXRE\x0aXSU\x0aXTS\x0aXUA" +
"\x0aXXX\x0aYDD\x0aYER\x08YUD\x0aYUM\x0aYUN\x0aYUR\x0aZAL\x0aZAR\x0aZMK" +
"\x08ZMW\x0aZRN\x0aZRZ\x0aZWD\x08ZWL\x0aZWR\x0a\xff\xff\xff\xff"
go.text/cldr: Upgraded cldr, display, and language package to CLDR 25. collatation is tricky and will be handled in a different CL. display: - Minor naming updates. language: - Added support for the provisional tag for Kosovo (XK). - Hani script is no longer a special case. Removed respective code. - Likely tags now make specialize a group region to a single country. This requires a new table for group regions. - addTags now specializes region groups whenever it can make an unambiguous choice. - Matching changed format. maketables now supports both. - Added Contains method to Region for determining wheter a region is contained by another. Do later: - Cash rounding and decimals for currencies. LGTM=r R=r CC=golang-codereviews, nigeltao https://golang.org/cl/102120044
2014-06-04 12:35:00 +04:00
// nRegionGroups is the number of region groups.
const nRegionGroups = 32
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
type likelyLangRegion struct {
lang uint16
region uint16
}
// likelyScript is a lookup table, indexed by scriptID, for the most likely
// languages and regions given a script.
text/language: updated tables with fresh IANA data. Change-Id: I7807c1f28528a946f124b97a136b0dbd352deba5 Reviewed-on: https://go-review.googlesource.com/6922 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-05 18:50:15 +03:00
// Size: 900 bytes, 225 elements
var likelyScript = [225]likelyLangRegion{
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x150, region: 0x104},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, region: 0x6a},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x15, region: 0x9a},
{lang: 0xeb, region: 0x27},
{lang: 0x8, region: 0x9a},
{lang: 0x26, region: 0x93},
{lang: 0x2a, region: 0x51},
{lang: 0x52, region: 0xb2},
{lang: 0x2b, region: 0x93},
{lang: 0x48, region: 0x34},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2b2, region: 0x12c},
{lang: 0x1da, region: 0x97},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, region: 0x76},
{lang: 0x58, region: 0x93},
{lang: 0x44, region: 0xe5},
{lang: 0x60, region: 0x34},
{lang: 0x70, region: 0x48},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x298, region: 0x129},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x6b, region: 0x13b},
{lang: 0x69, region: 0x132},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x6e, region: 0x6a},
{lang: 0xca, region: 0x5c},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1fc, region: 0x104},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xda, region: 0x97},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, region: 0x76},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x94, region: 0x6a},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x22d, region: 0x26},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x10, region: 0x6e},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x108, region: 0x7b},
{lang: 0x7a, region: 0x37},
{lang: 0xc9, region: 0x12e},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x202, region: 0x97},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x96, region: 0x85},
{lang: 0xcd, region: 0x97},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1cc, region: 0x97},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x12d, region: 0xa9},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2b2, region: 0x52},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xe1, region: 0xe5},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2b2, region: 0x52},
{lang: 0x2b2, region: 0x12c},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xd9, region: 0x95},
{lang: 0xff, region: 0xa0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xe0, region: 0xad},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x9c, region: 0x9c},
{lang: 0x106, region: 0x93},
{lang: 0xff, region: 0xa0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x95, region: 0xc2},
{lang: 0xff, region: 0xa0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1e0, region: 0xe6},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x12a, region: 0xa4},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x20f, region: 0x97},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x12c, region: 0x97},
{lang: 0x12d, region: 0xa9},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x39, region: 0x97},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1b8, region: 0x121},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x15c, region: 0xad},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14f, region: 0x97},
{lang: 0x153, region: 0x97},
{lang: 0x146, region: 0x85},
{lang: 0xca, region: 0x85},
{lang: 0x155, region: 0x52},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x29a, region: 0x129},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x29b, region: 0x129},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xda, region: 0x97},
{lang: 0x19e, region: 0x9a},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x29d, region: 0x52},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x176, region: 0x110},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x29e, region: 0x109},
{lang: 0x29e, region: 0x109},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x184, region: 0x97},
{lang: 0x18c, region: 0x97},
{lang: 0x185, region: 0x52},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x18f, region: 0x34},
{lang: 0x186, region: 0x97},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x19b, region: 0xc2},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x29f, region: 0x106},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x15, region: 0x9f},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x170, region: 0x82},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x217, region: 0x94},
{lang: 0x207, region: 0x97},
{lang: 0x1cb, region: 0xc3},
{lang: 0x1c9, region: 0x97},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x22b, region: 0x113},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x15, region: 0x11a},
{lang: 0x79, region: 0xc2},
{lang: 0x13e, region: 0x104},
{lang: 0x169, region: 0x52},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1ce, region: 0x9a},
{lang: 0x1ce, region: 0x52},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1d8, region: 0xae},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xdd, region: 0x52},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2a2, region: 0x9a},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1eb, region: 0x93},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1ba, region: 0x10a},
{lang: 0x227, region: 0x95},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2a3, region: 0x15b},
{lang: 0x208, region: 0x97},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x97, region: 0x79},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x202, region: 0x97},
{lang: 0x202, region: 0x97},
{lang: 0x20f, region: 0x97},
{lang: 0x21c, region: 0xb1},
{lang: 0x22f, region: 0x97},
{lang: 0x237, region: 0x93},
{lang: 0x240, region: 0x34},
{lang: 0x241, region: 0x99},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x245, region: 0xe5},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x87, region: 0x97},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x247, region: 0x52},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x11d, region: 0x52},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x243, region: 0x97},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x45, region: 0x13b},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x24a, region: 0x97},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2b1, region: 0xb8},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xa5, region: 0xe5},
{lang: 0x8c, region: 0xcb},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x24f, region: 0x121},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x49, region: 0x52},
{lang: 0x16e, region: 0x97},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x276, region: 0x11a},
{lang: 0x27f, region: 0xb2},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xe4, region: 0x97},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1d6, region: 0x9a},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xd, region: 0x99},
{lang: 0xf3, region: 0x52},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
{lang: 0x0, region: 0x0},
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
}
type likelyScriptRegion struct {
region uint16
script uint8
flags uint8
}
go.text/locale: some semantics and API changes - Defined 0 value to be "unspecified" id for languages, scripts and regions. These values are not directly exposed to the user, but rather are used to distinguish between the case where the user explicitly specifies, for example, Zzzz vs not specifying it. - The nil-value for ID now identifies Root. - Use Zyyy (undetermined) instead of Zzzz (uncoded, as used by CLDR) as the code for an unspecified script. CLDR uses Zzzz, but BCP47 prescribes using Zyyy in this case. With the new semantics is choice is somewhat arbitrary, so we stick with BCP47. - Added error to Canonicalize to accommodate future canonicalization algorithms. - Removed Parent and Written as their semantics are rather hazy. - Added Confidence to Language method as well. - Removed Scope methods. Instead, user should just filter pre-defined lists of IDs to mimic its functionality. - Added SetTypeForKey and removed KeyValueString. The same can be done with the former, but is much easier to use for the common case (change the type for a single key on an existing ID). - Removed SimplifyOptions as it is unclear such functionality should be exposed to the user or that it belongs in ID at all. Implemented: - Language, Script, Region - IsCountry R=r CC=golang-dev https://golang.org/cl/10697043
2013-07-08 23:10:26 +04:00
// likelyLang is a lookup table, indexed by langID, for the most likely
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
// scripts and regions given incomplete information. If more entries exist for a
go.text/locale: some semantics and API changes - Defined 0 value to be "unspecified" id for languages, scripts and regions. These values are not directly exposed to the user, but rather are used to distinguish between the case where the user explicitly specifies, for example, Zzzz vs not specifying it. - The nil-value for ID now identifies Root. - Use Zyyy (undetermined) instead of Zzzz (uncoded, as used by CLDR) as the code for an unspecified script. CLDR uses Zzzz, but BCP47 prescribes using Zyyy in this case. With the new semantics is choice is somewhat arbitrary, so we stick with BCP47. - Added error to Canonicalize to accommodate future canonicalization algorithms. - Removed Parent and Written as their semantics are rather hazy. - Added Confidence to Language method as well. - Removed Scope methods. Instead, user should just filter pre-defined lists of IDs to mimic its functionality. - Added SetTypeForKey and removed KeyValueString. The same can be done with the former, but is much easier to use for the common case (change the type for a single key on an existing ID). - Removed SimplifyOptions as it is unclear such functionality should be exposed to the user or that it belongs in ID at all. Implemented: - Language, Script, Region - IsCountry R=r CC=golang-dev https://golang.org/cl/10697043
2013-07-08 23:10:26 +04:00
// given language, region and script are the index and size respectively
// of the list in likelyLangList.
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
// Size: 2780 bytes, 695 elements
var likelyLang = [695]likelyScriptRegion{
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x132, script: 0x4f, flags: 0x0},
{region: 0x6e, script: 0x4f, flags: 0x0},
{region: 0x7b, script: 0x1d, flags: 0x0},
{region: 0x7e, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x12f, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0x7e, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x9a, script: 0x9, flags: 0x0},
{region: 0x126, script: 0x5, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x7e, script: 0x4f, flags: 0x0},
{region: 0x99, script: 0xd8, flags: 0x0},
{region: 0x14a, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x6e, script: 0x26, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x6a, script: 0x5, flags: 0x0},
{region: 0x0, script: 0x3, flags: 0x1},
{region: 0x50, script: 0x4f, flags: 0x0},
{region: 0x3e, script: 0x4f, flags: 0x0},
{region: 0x66, script: 0x5, flags: 0x0},
{region: 0xb8, script: 0x5, flags: 0x0},
{region: 0x6a, script: 0x5, flags: 0x0},
{region: 0x97, script: 0xe, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x6d, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x3e, script: 0x4f, flags: 0x0},
{region: 0x3, script: 0x4, flags: 0x1},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0x2d, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0xb, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x4e, script: 0x4f, flags: 0x0},
{region: 0x46, script: 0x1d, flags: 0x0},
{region: 0x15f, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0xc7, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x37, script: 0x1d, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x129, script: 0x2c, flags: 0x0},
{region: 0x97, script: 0x4a, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x13c, script: 0x4f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x13b, script: 0xc9, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0x34, script: 0xe, flags: 0x0},
{region: 0x52, script: 0xd0, flags: 0x0},
{region: 0x97, script: 0xe, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0x4e, script: 0x4f, flags: 0x0},
{region: 0x76, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x32, script: 0x4f, flags: 0x0},
{region: 0xb2, script: 0xc, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0xe6, script: 0x1f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x15c, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x84, script: 0x4f, flags: 0x0},
{region: 0x6c, script: 0x26, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0x6d, script: 0x4f, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x7, script: 0x2, flags: 0x1},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x12f, script: 0x4f, flags: 0x0},
{region: 0x88, script: 0x4f, flags: 0x0},
{region: 0x73, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0x132, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0x132, script: 0x19, flags: 0x0},
{region: 0xa4, script: 0x5, flags: 0x0},
{region: 0x13b, script: 0x18, flags: 0x0},
{region: 0x99, script: 0x5, flags: 0x0},
{region: 0x76, script: 0x4f, flags: 0x0},
{region: 0x6a, script: 0x1b, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x16, flags: 0x0},
{region: 0x48, script: 0x16, flags: 0x0},
{region: 0x48, script: 0x16, flags: 0x0},
{region: 0x48, script: 0x16, flags: 0x0},
{region: 0x48, script: 0x16, flags: 0x0},
{region: 0x108, script: 0x4f, flags: 0x0},
{region: 0x5d, script: 0x4f, flags: 0x0},
{region: 0xe7, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x16, flags: 0x0},
{region: 0xc2, script: 0x74, flags: 0x0},
{region: 0x9, script: 0x2, flags: 0x1},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x79, script: 0x4f, flags: 0x0},
{region: 0x62, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0x132, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x5, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0xd2, script: 0x4f, flags: 0x0},
{region: 0x4e, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x5, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0xce, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0xcb, script: 0xce, flags: 0x0},
{region: 0x112, script: 0x4f, flags: 0x0},
{region: 0x36, script: 0x4f, flags: 0x0},
{region: 0x42, script: 0xd0, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0x7e, script: 0x4f, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0x6a, script: 0x24, flags: 0x0},
{region: 0xc2, script: 0x40, flags: 0x0},
{region: 0x85, script: 0x2c, flags: 0x0},
{region: 0xb, script: 0x2, flags: 0x1},
{region: 0x1, script: 0x4f, flags: 0x0},
{region: 0x6d, script: 0x4f, flags: 0x0},
{region: 0x132, script: 0x4f, flags: 0x0},
{region: 0x69, script: 0x4f, flags: 0x0},
{region: 0x9c, script: 0x3c, flags: 0x0},
{region: 0x6d, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x6d, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0x84, script: 0x4f, flags: 0x0},
{region: 0x112, script: 0x4f, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0x70, script: 0x4f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x10a, script: 0x4f, flags: 0x0},
{region: 0x71, script: 0x4f, flags: 0x0},
{region: 0x74, script: 0x4f, flags: 0x0},
{region: 0x3a, script: 0x4f, flags: 0x0},
{region: 0x76, script: 0x4f, flags: 0x0},
{region: 0x132, script: 0x4f, flags: 0x0},
{region: 0x76, script: 0x4f, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0x13d, script: 0x4f, flags: 0x0},
{region: 0xd2, script: 0x4f, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0xd7, script: 0x4f, flags: 0x0},
{region: 0x94, script: 0x4f, flags: 0x0},
{region: 0x7e, script: 0x4f, flags: 0x0},
{region: 0xba, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0x32, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0x93, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0x7c, script: 0x4f, flags: 0x0},
{region: 0x79, script: 0x4f, flags: 0x0},
{region: 0x6e, script: 0x26, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xa5, script: 0x4f, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x6d, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0xef, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x97, script: 0xca, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0xd7, script: 0x4f, flags: 0x0},
{region: 0x12e, script: 0x2a, flags: 0x0},
{region: 0xd, script: 0x2, flags: 0x1},
{region: 0x97, script: 0xe, flags: 0x0},
{region: 0x4d, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x2d, flags: 0x0},
{region: 0x40, script: 0x4f, flags: 0x0},
{region: 0x53, script: 0x4f, flags: 0x0},
{region: 0x7e, script: 0x4f, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0x96, script: 0x4f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0xf, script: 0x3, flags: 0x1},
{region: 0x52, script: 0x32, flags: 0x0},
{region: 0x132, script: 0x4f, flags: 0x0},
{region: 0x23, script: 0x5, flags: 0x0},
{region: 0x95, script: 0x35, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x71, script: 0x1f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0x7b, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0xad, script: 0x38, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0xe4, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x8e, script: 0x4f, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0x32, flags: 0x0},
{region: 0x8f, script: 0x4f, flags: 0x0},
{region: 0x90, script: 0x4f, flags: 0x0},
{region: 0x27, script: 0x8, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0xd0, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x76, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0xce, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0xd9, flags: 0x0},
{region: 0x132, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0x9b, script: 0x4f, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x16, flags: 0x0},
{region: 0x95, script: 0x35, flags: 0x0},
{region: 0x104, script: 0x4f, flags: 0x0},
{region: 0xa0, script: 0x3e, flags: 0x0},
{region: 0x9e, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x12e, script: 0x35, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0x62, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x7b, script: 0x28, flags: 0x0},
{region: 0x134, script: 0x1d, flags: 0x0},
{region: 0x66, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0xc2, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x161, script: 0x4f, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x121, script: 0xcf, flags: 0x0},
{region: 0x59, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x4e, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x4a, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x40, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0xc6, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x67, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0x129, script: 0x4f, flags: 0x0},
{region: 0xd0, script: 0x4f, flags: 0x0},
{region: 0xad, script: 0x4c, flags: 0x0},
{region: 0x12, script: 0x6, flags: 0x1},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x80, script: 0x4f, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0xa4, script: 0x43, flags: 0x0},
{region: 0x29, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x47, flags: 0x0},
{region: 0xa9, script: 0x48, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x73, script: 0x4f, flags: 0x0},
{region: 0xb2, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x110, script: 0x4f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x97, script: 0x5, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0x18, script: 0x3, flags: 0x1},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x79, script: 0x4f, flags: 0x0},
{region: 0x121, script: 0xcf, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x1b, script: 0x5, flags: 0x1},
{region: 0x135, script: 0x4f, flags: 0x0},
{region: 0x85, script: 0x52, flags: 0x0},
{region: 0x95, script: 0x35, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x12f, script: 0x4f, flags: 0x0},
{region: 0xb5, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0xcf, flags: 0x0},
{region: 0x97, script: 0x50, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x12f, script: 0x4f, flags: 0x0},
{region: 0xd7, script: 0x4f, flags: 0x0},
{region: 0x20, script: 0x2, flags: 0x1},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0x54, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0x132, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0xca, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0x4a, script: 0x4f, flags: 0x0},
{region: 0xad, script: 0x4c, flags: 0x0},
{region: 0x4a, script: 0x4f, flags: 0x0},
{region: 0x15f, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0xb4, script: 0x4f, flags: 0x0},
{region: 0xb6, script: 0x4f, flags: 0x0},
{region: 0x4a, script: 0x4f, flags: 0x0},
{region: 0x4a, script: 0x4f, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0xb6, script: 0x4f, flags: 0x0},
{region: 0x121, script: 0xcf, flags: 0x0},
{region: 0x52, script: 0x32, flags: 0x0},
{region: 0x129, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x22, script: 0x3, flags: 0x1},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0xcd, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x110, script: 0x4f, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0x121, script: 0x5, flags: 0x0},
{region: 0xca, script: 0x4f, flags: 0x0},
{region: 0xbd, script: 0x4f, flags: 0x0},
{region: 0xcf, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0xbe, script: 0x4f, flags: 0x0},
{region: 0xde, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0xc0, script: 0x1d, flags: 0x0},
{region: 0x97, script: 0x60, flags: 0x0},
{region: 0x25, script: 0x3, flags: 0x1},
{region: 0x97, script: 0xe, flags: 0x0},
{region: 0xc2, script: 0x67, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0x36, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x34, script: 0x64, flags: 0x0},
{region: 0x28, script: 0x3, flags: 0x1},
{region: 0xc9, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0x132, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x161, script: 0x4f, flags: 0x0},
{region: 0xc2, script: 0x67, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x12f, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0x59, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0xdb, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0x32, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0xd0, script: 0x4f, flags: 0x0},
{region: 0xd8, script: 0x4f, flags: 0x0},
{region: 0xcd, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{region: 0x0, script: 0x0, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x161, script: 0x4f, flags: 0x0},
{region: 0xcf, script: 0x4f, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xd0, script: 0x4f, flags: 0x0},
{region: 0xcf, script: 0x4f, flags: 0x0},
{region: 0xcd, script: 0x4f, flags: 0x0},
{region: 0xcd, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0xdd, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x4f, flags: 0x0},
{region: 0xd7, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0xd8, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0xd8, script: 0x4f, flags: 0x0},
{region: 0x121, script: 0x4b, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x10a, script: 0xb1, flags: 0x0},
{region: 0x82, script: 0x6b, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x16, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x109, script: 0x4f, flags: 0x0},
{region: 0x132, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0x4f, flags: 0x0},
{region: 0xcc, script: 0x4f, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x12f, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0x7e, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x76, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0x6e, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x70, flags: 0x0},
{region: 0x7b, script: 0x1d, flags: 0x0},
{region: 0xc3, script: 0x6f, flags: 0x0},
{region: 0x2b, script: 0x3, flags: 0x1},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x2e, script: 0x2, flags: 0x1},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x2f, script: 0x4f, flags: 0x0},
{region: 0xee, script: 0x4f, flags: 0x0},
{region: 0x76, script: 0x4f, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x132, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0xd7, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0xae, script: 0x7a, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0x97, script: 0x11, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0xe7, script: 0x4f, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0x85, script: 0x2c, flags: 0x0},
{region: 0x73, script: 0x4f, flags: 0x0},
{region: 0xe6, script: 0x42, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0x1, script: 0x4f, flags: 0x0},
{region: 0x23, script: 0x5, flags: 0x0},
{region: 0x40, script: 0x4f, flags: 0x0},
{region: 0x78, script: 0x4f, flags: 0x0},
{region: 0xe2, script: 0x4f, flags: 0x0},
{region: 0x87, script: 0x4f, flags: 0x0},
{region: 0x68, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x4f, flags: 0x0},
{region: 0x100, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x4f, flags: 0x0},
{region: 0x30, script: 0x2, flags: 0x1},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0x34, script: 0xe, flags: 0x0},
{region: 0x4d, script: 0x4f, flags: 0x0},
{region: 0x70, script: 0x4f, flags: 0x0},
{region: 0x4d, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x0},
{region: 0x10a, script: 0x4f, flags: 0x0},
{region: 0x39, script: 0x4f, flags: 0x0},
{region: 0xcf, script: 0x4f, flags: 0x0},
{region: 0x102, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x71, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x12e, script: 0x1d, flags: 0x0},
{region: 0x107, script: 0x4f, flags: 0x0},
{region: 0x105, script: 0x4f, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0xa0, script: 0x41, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x7e, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0xa2, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0xb5, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0x79, script: 0x4f, flags: 0x0},
{region: 0x48, script: 0x4f, flags: 0x0},
{region: 0x32, script: 0x4, flags: 0x1},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0xd8, script: 0x4f, flags: 0x0},
{region: 0x4e, script: 0x4f, flags: 0x0},
{region: 0xcf, script: 0x4f, flags: 0x0},
{region: 0xcd, script: 0x4f, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0x4b, script: 0x4f, flags: 0x0},
{region: 0x94, script: 0x6d, flags: 0x0},
{region: 0xb4, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0xb8, script: 0xcc, flags: 0x0},
{region: 0xc2, script: 0x67, flags: 0x0},
{region: 0xb1, script: 0xbb, flags: 0x0},
{region: 0x6e, script: 0x4f, flags: 0x0},
{region: 0x10f, script: 0x4f, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x10d, script: 0x4f, flags: 0x0},
{region: 0xe7, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x13f, script: 0x4f, flags: 0x0},
{region: 0x10a, script: 0x4f, flags: 0x0},
{region: 0x10a, script: 0x4f, flags: 0x0},
{region: 0x70, script: 0x4f, flags: 0x0},
{region: 0x95, script: 0xb2, flags: 0x0},
{region: 0x70, script: 0x4f, flags: 0x0},
{region: 0x161, script: 0x4f, flags: 0x0},
{region: 0xc1, script: 0x4f, flags: 0x0},
{region: 0x113, script: 0x4f, flags: 0x0},
{region: 0x121, script: 0xcf, flags: 0x0},
{region: 0x26, script: 0x4f, flags: 0x0},
{region: 0x36, script: 0x5, flags: 0x1},
{region: 0x97, script: 0xbc, flags: 0x0},
{region: 0x114, script: 0x4f, flags: 0x0},
{region: 0x112, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x6c, script: 0x4f, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x82, script: 0x4f, flags: 0x0},
{region: 0x10a, script: 0x4f, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x15c, script: 0x5, flags: 0x0},
{region: 0x4a, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x93, script: 0x4f, flags: 0x0},
{region: 0x34, script: 0xe, flags: 0x0},
{region: 0x99, script: 0xbf, flags: 0x0},
{region: 0xe7, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0xc7, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x47, flags: 0x0},
{region: 0x52, script: 0xc5, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0x97, script: 0xca, flags: 0x0},
{region: 0x110, script: 0x4f, flags: 0x0},
{region: 0x12f, script: 0x4f, flags: 0x0},
{region: 0x124, script: 0x4f, flags: 0x0},
{region: 0x3b, script: 0x3, flags: 0x1},
{region: 0x121, script: 0xcf, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0x6e, script: 0x26, flags: 0x0},
{region: 0x6c, script: 0x26, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x125, script: 0x4f, flags: 0x0},
{region: 0x123, script: 0x4f, flags: 0x0},
{region: 0x31, script: 0x4f, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x31, script: 0x4f, flags: 0x0},
{region: 0xd2, script: 0x4f, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x127, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0xcc, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0xe4, script: 0x4f, flags: 0x0},
{region: 0x129, script: 0x4f, flags: 0x0},
{region: 0x129, script: 0x4f, flags: 0x0},
{region: 0x12c, script: 0x4f, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x85, script: 0x2c, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
{region: 0x42, script: 0xd0, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x12f, script: 0x4f, flags: 0x0},
{region: 0x121, script: 0xcf, flags: 0x0},
{region: 0x31, script: 0x4f, flags: 0x0},
{region: 0xcc, script: 0x4f, flags: 0x0},
{region: 0x12b, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0xd2, script: 0x4f, flags: 0x0},
{region: 0xe3, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0xb8, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x3e, script: 0x4, flags: 0x1},
{region: 0x11a, script: 0xd2, flags: 0x0},
{region: 0x12e, script: 0x1d, flags: 0x0},
{region: 0x73, script: 0x4f, flags: 0x0},
{region: 0x29, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0x42, script: 0x3, flags: 0x1},
{region: 0x97, script: 0xe, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x45, script: 0x4, flags: 0x1},
{region: 0xb2, script: 0xd3, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x9c, script: 0x4f, flags: 0x0},
{region: 0x104, script: 0x4f, flags: 0x0},
{region: 0x13b, script: 0x4f, flags: 0x0},
{region: 0x119, script: 0x4f, flags: 0x0},
{region: 0x35, script: 0x4f, flags: 0x0},
{region: 0x5f, script: 0x4f, flags: 0x0},
{region: 0xcf, script: 0x4f, flags: 0x0},
{region: 0x1, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0x104, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x69, script: 0x4f, flags: 0x0},
{region: 0x12d, script: 0x4f, flags: 0x0},
{region: 0x35, script: 0x4f, flags: 0x0},
{region: 0x4d, script: 0x4f, flags: 0x0},
{region: 0x6e, script: 0x26, flags: 0x0},
{region: 0xe5, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{region: 0x2e, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x97, script: 0xca, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x13d, script: 0x4f, flags: 0x0},
{region: 0x112, script: 0x4f, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x52, script: 0x32, flags: 0x0},
{region: 0x40, script: 0x4f, flags: 0x0},
{region: 0x129, script: 0x17, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x129, script: 0x56, flags: 0x0},
{region: 0x129, script: 0x57, flags: 0x0},
{region: 0x7b, script: 0x28, flags: 0x0},
{region: 0x52, script: 0x5a, flags: 0x0},
{region: 0x109, script: 0x5e, flags: 0x0},
{region: 0x106, script: 0x68, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x0},
{region: 0x12f, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0x7c, flags: 0x0},
{region: 0x15b, script: 0xb4, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0xcf, script: 0x4f, flags: 0x0},
{region: 0x73, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x4f, flags: 0x0},
{region: 0x1, script: 0x35, flags: 0x0},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x40, script: 0x4f, flags: 0x0},
{region: 0xcd, script: 0x4f, flags: 0x0},
{region: 0x52, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0xa6, script: 0x5, flags: 0x0},
{region: 0xd7, script: 0x4f, flags: 0x0},
{region: 0xb8, script: 0xcc, flags: 0x0},
{region: 0x49, script: 0x13, flags: 0x1},
{region: 0xce, script: 0x4f, flags: 0x0},
{region: 0x15e, script: 0x4f, flags: 0x0},
{region: 0x0, script: 0x0, flags: 0x0},
{region: 0x129, script: 0x4f, flags: 0x0},
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
}
// likelyLangList holds lists info associated with likelyLang.
text/language: upgraded to CLDR 26. - CLDR 26 introduced a new type of legacy language alias from ISO-639. Instead of having three different tables of language replacements, there is now just one where each entry is marked with a replacement type. - Moved to using go generate. - Introduced code file shared by maketables and package to make the use of constants a bit more manageable. Expect more to move there over time. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/166640043
2014-11-19 15:06:59 +03:00
// Size: 368 bytes, 92 elements
var likelyLangList = [92]likelyScriptRegion{
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{region: 0x9a, script: 0x7, flags: 0x0},
{region: 0x9f, script: 0x69, flags: 0x2},
{region: 0x11a, script: 0x73, flags: 0x2},
{region: 0x31, script: 0x4f, flags: 0x0},
{region: 0x9a, script: 0x5, flags: 0x4},
{region: 0x104, script: 0x1d, flags: 0x4},
{region: 0x9a, script: 0x5, flags: 0x2},
{region: 0x97, script: 0xe, flags: 0x0},
{region: 0x34, script: 0x15, flags: 0x2},
{region: 0x104, script: 0x1d, flags: 0x0},
{region: 0x37, script: 0x29, flags: 0x2},
{region: 0x132, script: 0x4f, flags: 0x0},
{region: 0x79, script: 0xb7, flags: 0x2},
{region: 0x5c, script: 0x1c, flags: 0x0},
{region: 0x85, script: 0x53, flags: 0x2},
{region: 0xd4, script: 0x4f, flags: 0x0},
{region: 0x51, script: 0x5, flags: 0x4},
{region: 0x109, script: 0x5, flags: 0x4},
{region: 0xac, script: 0x1d, flags: 0x0},
{region: 0x23, script: 0x5, flags: 0x4},
{region: 0x52, script: 0x5, flags: 0x4},
{region: 0x9a, script: 0x5, flags: 0x4},
{region: 0xc3, script: 0x5, flags: 0x4},
{region: 0x52, script: 0x5, flags: 0x2},
{region: 0x129, script: 0x4f, flags: 0x0},
{region: 0xae, script: 0x5, flags: 0x4},
{region: 0x99, script: 0x5, flags: 0x2},
{region: 0xa3, script: 0x1d, flags: 0x0},
{region: 0x52, script: 0x5, flags: 0x4},
{region: 0x129, script: 0x4f, flags: 0x4},
{region: 0x52, script: 0x5, flags: 0x2},
{region: 0x129, script: 0x4f, flags: 0x2},
{region: 0xd9, script: 0x1f, flags: 0x0},
{region: 0x97, script: 0x51, flags: 0x2},
{region: 0x81, script: 0x4f, flags: 0x0},
{region: 0x82, script: 0x6b, flags: 0x4},
{region: 0x82, script: 0x6b, flags: 0x2},
{region: 0xc3, script: 0x1d, flags: 0x0},
{region: 0x52, script: 0x62, flags: 0x4},
{region: 0x52, script: 0x62, flags: 0x2},
{region: 0xce, script: 0x4f, flags: 0x0},
{region: 0x49, script: 0x5, flags: 0x4},
{region: 0x93, script: 0x5, flags: 0x4},
{region: 0x97, script: 0x2e, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x4},
{region: 0xe6, script: 0x5, flags: 0x2},
{region: 0x9a, script: 0x77, flags: 0x0},
{region: 0x52, script: 0x78, flags: 0x2},
{region: 0xb8, script: 0xcc, flags: 0x0},
{region: 0xd7, script: 0x4f, flags: 0x4},
{region: 0xe6, script: 0x5, flags: 0x0},
{region: 0x97, script: 0x1f, flags: 0x2},
{region: 0x97, script: 0x44, flags: 0x2},
{region: 0x97, script: 0xba, flags: 0x2},
{region: 0x103, script: 0x1d, flags: 0x0},
{region: 0xbb, script: 0x4f, flags: 0x4},
{region: 0x102, script: 0x4f, flags: 0x4},
{region: 0x104, script: 0x4f, flags: 0x4},
{region: 0x129, script: 0x4f, flags: 0x4},
{region: 0x122, script: 0x1d, flags: 0x0},
{region: 0xe6, script: 0x5, flags: 0x4},
{region: 0xe6, script: 0x5, flags: 0x2},
{region: 0x52, script: 0x5, flags: 0x0},
{region: 0xac, script: 0x1d, flags: 0x4},
{region: 0xc3, script: 0x1d, flags: 0x4},
{region: 0xac, script: 0x1d, flags: 0x2},
{region: 0x97, script: 0xe, flags: 0x0},
{region: 0xd9, script: 0x1f, flags: 0x4},
{region: 0xd9, script: 0x1f, flags: 0x2},
{region: 0x134, script: 0x4f, flags: 0x0},
{region: 0x23, script: 0x5, flags: 0x4},
{region: 0x52, script: 0x1d, flags: 0x4},
{region: 0x23, script: 0x5, flags: 0x2},
{region: 0x52, script: 0x32, flags: 0x0},
{region: 0x2e, script: 0x33, flags: 0x4},
{region: 0x3d, script: 0x33, flags: 0x4},
{region: 0x79, script: 0x33, flags: 0x4},
{region: 0x7c, script: 0x33, flags: 0x4},
{region: 0x8b, script: 0x33, flags: 0x4},
{region: 0x93, script: 0x33, flags: 0x4},
{region: 0xc4, script: 0x33, flags: 0x4},
{region: 0xce, script: 0x33, flags: 0x4},
{region: 0xe0, script: 0x33, flags: 0x4},
{region: 0xe3, script: 0x33, flags: 0x4},
{region: 0xe5, script: 0x33, flags: 0x4},
{region: 0x114, script: 0x33, flags: 0x4},
{region: 0x121, script: 0x33, flags: 0x4},
{region: 0x12c, script: 0x33, flags: 0x4},
{region: 0x132, script: 0x33, flags: 0x4},
{region: 0x13b, script: 0x33, flags: 0x4},
{region: 0x12c, script: 0x10, flags: 0x2},
{region: 0x12c, script: 0x33, flags: 0x2},
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
}
type likelyLangScript struct {
lang uint16
script uint8
flags uint8
}
// likelyRegion is a lookup table, indexed by regionID, for the most likely
// languages and scripts given incomplete information. If more entries exist
go.text/locale: some semantics and API changes - Defined 0 value to be "unspecified" id for languages, scripts and regions. These values are not directly exposed to the user, but rather are used to distinguish between the case where the user explicitly specifies, for example, Zzzz vs not specifying it. - The nil-value for ID now identifies Root. - Use Zyyy (undetermined) instead of Zzzz (uncoded, as used by CLDR) as the code for an unspecified script. CLDR uses Zzzz, but BCP47 prescribes using Zyyy in this case. With the new semantics is choice is somewhat arbitrary, so we stick with BCP47. - Added error to Canonicalize to accommodate future canonicalization algorithms. - Removed Parent and Written as their semantics are rather hazy. - Added Confidence to Language method as well. - Removed Scope methods. Instead, user should just filter pre-defined lists of IDs to mimic its functionality. - Added SetTypeForKey and removed KeyValueString. The same can be done with the former, but is much easier to use for the common case (change the type for a single key on an existing ID). - Removed SimplifyOptions as it is unclear such functionality should be exposed to the user or that it belongs in ID at all. Implemented: - Language, Script, Region - IsCountry R=r CC=golang-dev https://golang.org/cl/10697043
2013-07-08 23:10:26 +04:00
// for a given regionID, lang and script are the index and size respectively
// of the list in likelyRegionList.
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
// TODO: exclude containers and user-definable regions from the list.
go.text/language: canonicalize deprecated regions and scripts. Analoguous to deprecated languages, deprecated regions are represented with their own internal codes and get canonicalized when necessary. The deprecated regions were previously not recognized. - refactored code for writing sorted maps. - refactored region testing code in separate components to simplify tests. - CLDR does not include the deprecated 3-letter ISO codes for all deprecated codes. We added them for completeness. - Script deprecation is hard-coded. The CLDR data only contains one remapping. maketables.go checks that this is indeed the only one. This adds about 250 bytes of data. R=r CC=golang-dev https://golang.org/cl/19850043
2013-11-08 15:52:05 +04:00
// Size: 1420 bytes, 355 elements
var likelyRegion = [355]likelyLangScript{
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x5e, script: 0x4f, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x2, flags: 0x1},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x2, script: 0x2, flags: 0x1},
{lang: 0x4, script: 0x2, flags: 0x1},
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1e4, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x223, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x82, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1b3, script: 0x4f, flags: 0x0},
{lang: 0x23a, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x22, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x6, script: 0x2, flags: 0x1},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x48, script: 0xe, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1b3, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x36, script: 0x1d, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1f6, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x190, script: 0x4f, flags: 0x0},
{lang: 0x99, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1d0, script: 0x4f, flags: 0x0},
{lang: 0x1e4, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x8, script: 0x2, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x4f, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x2e, script: 0x1d, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2a9, script: 0x35, flags: 0x2},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x190, script: 0x5, flags: 0x2},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x23b, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x82, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0xa, script: 0x4, flags: 0x1},
{lang: 0x99, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1e4, script: 0x4f, flags: 0x0},
{lang: 0x1d0, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xe, script: 0x2, flags: 0x1},
{lang: 0x76, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x82, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x1, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x7d, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x10, script: 0x2, flags: 0x1},
{lang: 0x99, script: 0x4f, flags: 0x0},
{lang: 0x99, script: 0x4f, flags: 0x0},
{lang: 0x9b, script: 0x4f, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x253, script: 0x26, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x12, script: 0x2, flags: 0x1},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xa4, script: 0x4f, flags: 0x0},
{lang: 0xdb, script: 0x1f, flags: 0x2},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xa8, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x14, script: 0x2, flags: 0x1},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x16, script: 0x3, flags: 0x1},
{lang: 0xaa, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xc, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x128, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x99, script: 0x4f, flags: 0x0},
{lang: 0x19, script: 0x2, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1e4, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2b2, script: 0x33, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0xe6, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xe9, script: 0x4f, flags: 0x0},
{lang: 0xea, script: 0x4f, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x99, script: 0x4f, flags: 0x0},
{lang: 0x1b, script: 0x2, flags: 0x1},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0xd9, script: 0x35, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x1d, script: 0x3, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, script: 0x5, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x20, script: 0x2, flags: 0x1},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xfa, script: 0x4f, flags: 0x0},
{lang: 0xfb, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0xff, script: 0x3e, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x23b, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x144, script: 0x1d, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x22, script: 0x3, flags: 0x1},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x25, script: 0x2, flags: 0x1},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x12d, script: 0x48, flags: 0x0},
{lang: 0x12d, script: 0x48, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1fc, script: 0x1d, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x27, script: 0x2, flags: 0x1},
{lang: 0x14, script: 0x5, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x82, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x21c, script: 0xbb, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x235, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x160, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x167, script: 0x4f, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0x29, script: 0x2, flags: 0x1},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x2b, script: 0x2, flags: 0x1},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x22e, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x17a, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x2d, script: 0x2, flags: 0x1},
{lang: 0x46, script: 0x4f, flags: 0x0},
{lang: 0x2f, script: 0x2, flags: 0x1},
{lang: 0x31, script: 0x2, flags: 0x1},
{lang: 0x33, script: 0x2, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x35, script: 0x2, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x191, script: 0x4f, flags: 0x0},
{lang: 0x37, script: 0x3, flags: 0x1},
{lang: 0x8c, script: 0xce, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
{lang: 0x190, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1e4, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xa, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0xd5, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xd5, script: 0x5, flags: 0x2},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1b3, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x1a4, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1aa, script: 0x1f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0x99, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x260, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xa5, script: 0x4f, flags: 0x0},
{lang: 0x3a, script: 0x3, flags: 0x1},
{lang: 0x3d, script: 0x2, flags: 0x1},
{lang: 0xaa, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1e4, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1d1, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xc4, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, script: 0x5, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x3f, script: 0x2, flags: 0x1},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x22e, script: 0x1d, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x41, script: 0x2, flags: 0x1},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1ff, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, script: 0x5, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0x43, script: 0x2, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x220, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x1a4, script: 0x4f, flags: 0x0},
{lang: 0x45, script: 0x2, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xfb, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x22b, script: 0x4f, flags: 0x0},
{lang: 0x1b3, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1e4, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x47, script: 0x2, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x49, script: 0x3, flags: 0x1},
{lang: 0x4c, script: 0x2, flags: 0x1},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x257, script: 0x4f, flags: 0x0},
{lang: 0x1e4, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x256, script: 0x4f, flags: 0x0},
{lang: 0x4e, script: 0x2, flags: 0x1},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x25e, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x50, script: 0x3, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x26e, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x53, script: 0x2, flags: 0x1},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x23b, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x55, script: 0x3, flags: 0x1},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x23b, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2a9, script: 0x35, flags: 0x2},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x27e, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xfb, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x99, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x283, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x3e, script: 0x4f, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x223, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x58, script: 0x2, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0x5a, script: 0x2, flags: 0x1},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
{lang: 0x0, script: 0x0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x229, script: 0x4f, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, script: 0x0, flags: 0x0},
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
}
go.text/locale: some semantics and API changes - Defined 0 value to be "unspecified" id for languages, scripts and regions. These values are not directly exposed to the user, but rather are used to distinguish between the case where the user explicitly specifies, for example, Zzzz vs not specifying it. - The nil-value for ID now identifies Root. - Use Zyyy (undetermined) instead of Zzzz (uncoded, as used by CLDR) as the code for an unspecified script. CLDR uses Zzzz, but BCP47 prescribes using Zyyy in this case. With the new semantics is choice is somewhat arbitrary, so we stick with BCP47. - Added error to Canonicalize to accommodate future canonicalization algorithms. - Removed Parent and Written as their semantics are rather hazy. - Added Confidence to Language method as well. - Removed Scope methods. Instead, user should just filter pre-defined lists of IDs to mimic its functionality. - Added SetTypeForKey and removed KeyValueString. The same can be done with the former, but is much easier to use for the common case (change the type for a single key on an existing ID). - Removed SimplifyOptions as it is unclear such functionality should be exposed to the user or that it belongs in ID at all. Implemented: - Language, Script, Region - IsCountry R=r CC=golang-dev https://golang.org/cl/10697043
2013-07-08 23:10:26 +04:00
// likelyRegionList holds lists info associated with likelyRegion.
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
// Size: 368 bytes, 92 elements
var likelyRegionList = [92]likelyLangScript{
{lang: 0xa0, script: 0x5, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x256, script: 0x4f, flags: 0x0},
{lang: 0x22d, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x183, script: 0x1d, flags: 0x0},
{lang: 0xeb, script: 0x8, flags: 0x0},
{lang: 0x13c, script: 0x4f, flags: 0x0},
{lang: 0x51, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x22e, script: 0x1d, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x8f, script: 0xd0, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1aa, script: 0x1f, flags: 0x0},
{lang: 0x2b2, script: 0x32, flags: 0x0},
{lang: 0x275, script: 0x5, flags: 0x0},
{lang: 0x2ad, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14e, script: 0xcf, flags: 0x0},
{lang: 0x96, script: 0x2c, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x261, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x10, script: 0x26, flags: 0x0},
{lang: 0x97, script: 0x4f, flags: 0x0},
{lang: 0x138, script: 0x5, flags: 0x2},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2a9, script: 0x35, flags: 0x2},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x108, script: 0x28, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x2, script: 0x1d, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x13c, script: 0x4f, flags: 0x0},
{lang: 0x96, script: 0x2c, flags: 0x0},
{lang: 0x183, script: 0x1d, flags: 0x0},
{lang: 0xf0, script: 0x4f, flags: 0x0},
{lang: 0x190, script: 0x5, flags: 0x0},
{lang: 0xda, script: 0x1f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x27d, script: 0x5, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x120, script: 0x67, flags: 0x0},
{lang: 0xa0, script: 0x5, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x256, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x12a, script: 0x43, flags: 0x0},
{lang: 0x6a, script: 0x5, flags: 0x0},
{lang: 0x113, script: 0xcf, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x15c, script: 0x4c, flags: 0x0},
{lang: 0x113, script: 0xcf, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1f8, script: 0x4f, flags: 0x0},
{lang: 0x277, script: 0x1d, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x183, script: 0x1d, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x22d, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x19b, script: 0x67, flags: 0x0},
{lang: 0x10b, script: 0x4f, flags: 0x0},
{lang: 0x185, script: 0x1d, flags: 0x0},
{lang: 0x126, script: 0x5, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2b2, script: 0x33, flags: 0x0},
{lang: 0x1e4, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
{lang: 0x179, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x27d, script: 0x5, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x3d, script: 0x1f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x27d, script: 0x5, flags: 0x0},
{lang: 0x27d, script: 0x5, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x55, script: 0x1f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1dc, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x2e, script: 0x1d, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1f8, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x36, script: 0x1d, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1fc, script: 0x1d, flags: 0x0},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x136, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x23a, script: 0x4f, flags: 0x0},
{lang: 0x2a9, script: 0x35, flags: 0x0},
{lang: 0x21e, script: 0x4f, flags: 0x0},
{lang: 0x277, script: 0x1d, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x24f, script: 0xcf, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x178, script: 0x5, flags: 0x0},
{lang: 0x187, script: 0x67, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x24e, script: 0x1d, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xa0, script: 0x5, flags: 0x0},
{lang: 0x14, script: 0x5, flags: 0x0},
{lang: 0xaa, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x261, script: 0x4f, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x10f, script: 0x1d, flags: 0x0},
{lang: 0x38, script: 0x2c, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2b2, script: 0x33, flags: 0x0},
{lang: 0x263, script: 0x4f, flags: 0x0},
{lang: 0x277, script: 0x1d, flags: 0x0},
{lang: 0x2a9, script: 0x35, flags: 0x0},
{lang: 0x1dc, script: 0x4f, flags: 0x0},
{lang: 0x22d, script: 0x4f, flags: 0x0},
{lang: 0x22e, script: 0x1d, flags: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xaa, script: 0x4f, flags: 0x0},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x23c, script: 0x5, flags: 0x0},
go.text/cldr: Upgraded cldr, display, and language package to CLDR 25. collatation is tricky and will be handled in a different CL. display: - Minor naming updates. language: - Added support for the provisional tag for Kosovo (XK). - Hani script is no longer a special case. Removed respective code. - Likely tags now make specialize a group region to a single country. This requires a new table for group regions. - addTags now specializes region groups whenever it can make an unambiguous choice. - Matching changed format. maketables now supports both. - Added Contains method to Region for determining wheter a region is contained by another. Do later: - Cash rounding and decimals for currencies. LGTM=r R=r CC=golang-codereviews, nigeltao https://golang.org/cl/102120044
2014-06-04 12:35:00 +04:00
}
type likelyTag struct {
lang uint16
region uint16
script uint8
}
// Size: 192 bytes, 32 elements
var likelyRegionGroup = [32]likelyTag{
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, region: 0x0, script: 0x0},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x97, region: 0xd4, script: 0x4f},
{lang: 0x97, region: 0x132, script: 0x4f},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1e4, region: 0x40, script: 0x4f},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x97, region: 0x2e, script: 0x4f},
{lang: 0x97, region: 0xd4, script: 0x4f},
{lang: 0x99, region: 0xcd, script: 0x4f},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x23b, region: 0x12d, script: 0x4f},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, region: 0x6a, script: 0x5},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x23b, region: 0x4a, script: 0x4f},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x97, region: 0x15e, script: 0x4f},
{lang: 0x97, region: 0x132, script: 0x4f},
{lang: 0x97, region: 0x132, script: 0x4f},
{lang: 0x99, region: 0x58, script: 0x4f},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x2b2, region: 0x52, script: 0x32},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0xda, region: 0x97, script: 0x1f},
{lang: 0xf0, region: 0x93, script: 0x4f},
{lang: 0xfb, region: 0x9c, script: 0x4f},
{lang: 0x97, region: 0x2e, script: 0x4f},
{lang: 0x97, region: 0xe4, script: 0x4f},
{lang: 0x97, region: 0x88, script: 0x4f},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x223, region: 0x13f, script: 0x4f},
{lang: 0x2b2, region: 0x52, script: 0x32},
{lang: 0x27e, region: 0x134, script: 0x4f},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x14, region: 0x106, script: 0x5},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1fc, region: 0x104, script: 0x1d},
{lang: 0x1fc, region: 0x104, script: 0x1d},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{lang: 0x97, region: 0x79, script: 0x4f},
{lang: 0x82, region: 0x5f, script: 0x4f},
{lang: 0x99, region: 0x1e, script: 0x4f},
{lang: 0x97, region: 0x98, script: 0x4f},
{lang: 0x97, region: 0x79, script: 0x4f},
go.text/locale: implemented likely subtag computation, based on CLDR likelySubtag data. Some minor refactorings: - pVariant and pExt now always point at the expected position in the string (if any), even if variants and/or extensions are not defined. - adjusted makeString accordingly and renamed it to remakeString. - added writeType and writeConsts methods in maketables.go - writeSlice now removes main. from types. - extra indirection for getLangISO3 as there are now more than 256 indexable language codes. At some point we could consider adding addLikleySubtags and minimize to the API to provide similar functionality as ICU. However, if it works, it seems nicer to include this functionalty as an option to Canonicalize. The use of this is rather esoteric, especially considering there are other ways in the API to get to this information more intuitively. R=r CC=golang-dev https://golang.org/cl/10082046
2013-06-11 16:26:01 +04:00
}
go.text/language: added tag matching algorithm. This algorithm is not based on the CLDR algorithm. It incorporates some ideas from other implementations, but it is designed from scratch. Note that the IANA registry has been updated so this CL also adds some new language codes as well as add mappings for deprecated codes. maketables.go has also been modified to work around a bug that was introduced in the latest IANA update. Note that the Match method of the Matcher interface returns an index of the original Tag along with the Tag. Certain users of Matcher, such as service like collation, need to associate data with each Tag. Package collate is updated to use the new Matcher interface. As the Matcher matches returns the index of the Tag as well, the tables can be simplified to be an array instead of a map. R=r, nigeltao, mpvl CC=golang-dev, markdavis https://golang.org/cl/13819047
2013-10-07 15:14:45 +04:00
type mutualIntelligibility struct {
want uint16
have uint16
conf uint8
oneway bool
}
type scriptIntelligibility struct {
go.text/language: tweaked language matcher and fixed some anomalies. - No longer takes transitive closure of languageMatch entries. E.g. A Dane will understand Norwegian Bokmål. A writer of Bokmål will undestand Norwegian Nynorsk, but a Dane will typically not understand Nynorsk. - Changed langMatch entries with a percentage of 90 to be High instead of Low. (An arbitrary choice, but seems better.) - Fixed matching of sr-Latn vs sr-Cyrl. - Language-specific script mappings are now supported. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/68190043
2014-02-28 01:29:49 +04:00
lang uint16
go.text/language: added tag matching algorithm. This algorithm is not based on the CLDR algorithm. It incorporates some ideas from other implementations, but it is designed from scratch. Note that the IANA registry has been updated so this CL also adds some new language codes as well as add mappings for deprecated codes. maketables.go has also been modified to work around a bug that was introduced in the latest IANA update. Note that the Match method of the Matcher interface returns an index of the original Tag along with the Tag. Certain users of Matcher, such as service like collation, need to associate data with each Tag. Package collate is updated to use the new Matcher interface. As the Matcher matches returns the index of the Tag as well, the tables can be simplified to be an array instead of a map. R=r, nigeltao, mpvl CC=golang-dev, markdavis https://golang.org/cl/13819047
2013-10-07 15:14:45 +04:00
want uint8
have uint8
conf uint8
}
// matchLang holds pairs of langIDs of base languages that are typically
// mutually intelligible. Each pair is associated with a confidence and
// whether the intelligibility goes one or both ways.
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
// Size: 702 bytes, 117 elements
var matchLang = [117]mutualIntelligibility{
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x1b7, have: 0x1a4, conf: 0x2, oneway: false},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0xe6, have: 0x51, conf: 0x2, oneway: false},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x219, have: 0x51, conf: 0x2, oneway: false},
{want: 0x22e, have: 0x51, conf: 0x2, oneway: false},
{want: 0x219, have: 0xe6, conf: 0x2, oneway: false},
{want: 0x22e, have: 0xe6, conf: 0x2, oneway: false},
{want: 0x219, have: 0x22e, conf: 0x2, oneway: false},
{want: 0x234, have: 0x1, conf: 0x2, oneway: false},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0xcc, have: 0x82, conf: 0x2, oneway: true},
{want: 0x14b, have: 0x82, conf: 0x2, oneway: true},
{want: 0x13c, have: 0x6c, conf: 0x2, oneway: false},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x7d, have: 0x1b7, conf: 0x2, oneway: false},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0x7d, have: 0x1a4, conf: 0x2, oneway: false},
{want: 0x6c, have: 0x14, conf: 0x2, oneway: true},
{want: 0x6d, have: 0xaa, conf: 0x2, oneway: true},
{want: 0x75, have: 0xaa, conf: 0x2, oneway: true},
{want: 0x7c, have: 0x97, conf: 0x2, oneway: true},
{want: 0x91, have: 0x97, conf: 0x2, oneway: true},
{want: 0x98, have: 0x97, conf: 0x2, oneway: true},
{want: 0x9b, have: 0xa4, conf: 0x2, oneway: true},
{want: 0x9d, have: 0x99, conf: 0x2, oneway: true},
{want: 0xa8, have: 0x7d, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0xb3, have: 0x1b3, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0xb4, have: 0x97, conf: 0x2, oneway: true},
{want: 0xb5, have: 0x97, conf: 0x2, oneway: true},
{want: 0xbc, have: 0x97, conf: 0x2, oneway: true},
{want: 0xc2, have: 0x99, conf: 0x2, oneway: true},
{want: 0xc4, have: 0x99, conf: 0x2, oneway: true},
{want: 0xcd, have: 0xda, conf: 0x2, oneway: true},
{want: 0xd5, have: 0x97, conf: 0x2, oneway: true},
{want: 0xd7, have: 0x97, conf: 0x2, oneway: true},
{want: 0xe9, have: 0xaa, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0xeb, have: 0x1fc, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0xed, have: 0x97, conf: 0x2, oneway: true},
{want: 0xf2, have: 0x97, conf: 0x2, oneway: true},
{want: 0xfa, have: 0x97, conf: 0x2, oneway: true},
{want: 0x106, have: 0xf0, conf: 0x2, oneway: true},
{want: 0x108, have: 0x97, conf: 0x2, oneway: true},
{want: 0x119, have: 0xaa, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x126, have: 0x1fc, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0x12a, have: 0x97, conf: 0x2, oneway: true},
{want: 0x12c, have: 0x97, conf: 0x2, oneway: true},
{want: 0x134, have: 0x97, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x13c, have: 0x261, conf: 0x2, oneway: true},
{want: 0x144, have: 0x1fc, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0x145, have: 0xfb, conf: 0x2, oneway: true},
{want: 0x151, have: 0x97, conf: 0x2, oneway: true},
{want: 0x15b, have: 0xaa, conf: 0x2, oneway: true},
{want: 0x15c, have: 0x97, conf: 0x2, oneway: true},
{want: 0x15e, have: 0x97, conf: 0x2, oneway: true},
{want: 0x163, have: 0xaa, conf: 0x2, oneway: true},
{want: 0x179, have: 0x97, conf: 0x2, oneway: true},
{want: 0x17a, have: 0xaa, conf: 0x2, oneway: true},
{want: 0x180, have: 0x97, conf: 0x2, oneway: true},
{want: 0x183, have: 0x36, conf: 0x2, oneway: true},
{want: 0x184, have: 0x97, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x185, have: 0x1fc, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0x18c, have: 0xda, conf: 0x2, oneway: true},
{want: 0x190, have: 0xf0, conf: 0x2, oneway: true},
{want: 0x191, have: 0x97, conf: 0x2, oneway: true},
{want: 0x19b, have: 0x97, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x1aa, have: 0x97, conf: 0x2, oneway: true},
{want: 0x1b5, have: 0x1a4, conf: 0x2, oneway: false},
{want: 0x1b5, have: 0x1b7, conf: 0x2, oneway: true},
{want: 0x1be, have: 0x97, conf: 0x2, oneway: true},
{want: 0x1c2, have: 0x97, conf: 0x2, oneway: true},
{want: 0x1c4, have: 0x97, conf: 0x2, oneway: true},
{want: 0x1c6, have: 0xaa, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0x1c8, have: 0x97, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x1c9, have: 0x97, conf: 0x2, oneway: true},
{want: 0x1cc, have: 0x97, conf: 0x2, oneway: true},
{want: 0x1d3, have: 0x97, conf: 0x2, oneway: true},
{want: 0x1e3, have: 0x97, conf: 0x2, oneway: true},
{want: 0x1e6, have: 0x99, conf: 0x2, oneway: true},
{want: 0x1f1, have: 0x82, conf: 0x2, oneway: true},
{want: 0x1f6, have: 0x97, conf: 0x2, oneway: true},
{want: 0x1ff, have: 0xaa, conf: 0x2, oneway: true},
{want: 0x202, have: 0xda, conf: 0x2, oneway: true},
{want: 0x20f, have: 0x97, conf: 0x2, oneway: true},
{want: 0x21c, have: 0x97, conf: 0x2, oneway: true},
{want: 0x229, have: 0x97, conf: 0x2, oneway: true},
{want: 0x22b, have: 0x97, conf: 0x2, oneway: true},
{want: 0x22d, have: 0x97, conf: 0x2, oneway: true},
{want: 0x235, have: 0x97, conf: 0x2, oneway: true},
{want: 0x237, have: 0xf0, conf: 0x2, oneway: true},
{want: 0x23b, have: 0x97, conf: 0x2, oneway: true},
{want: 0x243, have: 0x97, conf: 0x2, oneway: true},
{want: 0x24a, have: 0x97, conf: 0x2, oneway: true},
{want: 0x24e, have: 0x1fc, conf: 0x2, oneway: true},
{want: 0x253, have: 0x97, conf: 0x2, oneway: true},
{want: 0x256, have: 0x1fc, conf: 0x2, oneway: true},
{want: 0x3608, have: 0x97, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0x25d, have: 0x97, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x25e, have: 0x97, conf: 0x2, oneway: true},
{want: 0x269, have: 0x1fc, conf: 0x2, oneway: true},
{want: 0x26d, have: 0x97, conf: 0x2, oneway: true},
{want: 0x275, have: 0x2b2, conf: 0x2, oneway: true},
{want: 0x27d, have: 0x97, conf: 0x2, oneway: true},
{want: 0x27e, have: 0x1fc, conf: 0x2, oneway: true},
{want: 0x294, have: 0xaa, conf: 0x2, oneway: true},
{want: 0x299, have: 0x97, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0x2a9, have: 0x97, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x2aa, have: 0x97, conf: 0x2, oneway: true},
{want: 0x2b4, have: 0x97, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0x5, have: 0x97, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x2, have: 0x1fc, conf: 0x2, oneway: true},
{want: 0xa, have: 0x1b3, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0xc, have: 0x97, conf: 0x2, oneway: true},
{want: 0x21, have: 0x99, conf: 0x2, oneway: true},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{want: 0x22, have: 0x1fc, conf: 0x2, oneway: true},
{want: 0x2e, have: 0x1fc, conf: 0x2, oneway: true},
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
{want: 0x2f, have: 0x97, conf: 0x2, oneway: true},
{want: 0x39, have: 0xda, conf: 0x2, oneway: true},
{want: 0x48, have: 0x97, conf: 0x2, oneway: true},
{want: 0x4d, have: 0xaa, conf: 0x2, oneway: true},
{want: 0x62, have: 0xa5, conf: 0x2, oneway: true},
{want: 0x69, have: 0x97, conf: 0x2, oneway: true},
go.text/language: added tag matching algorithm. This algorithm is not based on the CLDR algorithm. It incorporates some ideas from other implementations, but it is designed from scratch. Note that the IANA registry has been updated so this CL also adds some new language codes as well as add mappings for deprecated codes. maketables.go has also been modified to work around a bug that was introduced in the latest IANA update. Note that the Match method of the Matcher interface returns an index of the original Tag along with the Tag. Certain users of Matcher, such as service like collation, need to associate data with each Tag. Package collate is updated to use the new Matcher interface. As the Matcher matches returns the index of the Tag as well, the tables can be simplified to be an array instead of a map. R=r, nigeltao, mpvl CC=golang-dev, markdavis https://golang.org/cl/13819047
2013-10-07 15:14:45 +04:00
}
// matchScript holds pairs of scriptIDs where readers of one script
// can typically also read the other. Each is associated with a confidence.
go.text/language: tweaked language matcher and fixed some anomalies. - No longer takes transitive closure of languageMatch entries. E.g. A Dane will understand Norwegian Bokmål. A writer of Bokmål will undestand Norwegian Nynorsk, but a Dane will typically not understand Nynorsk. - Changed langMatch entries with a percentage of 90 to be High instead of Low. (An arbitrary choice, but seems better.) - Fixed matching of sr-Latn vs sr-Cyrl. - Language-specific script mappings are now supported. LGTM=r R=r CC=golang-codereviews https://golang.org/cl/68190043
2014-02-28 01:29:49 +04:00
// Size: 24 bytes, 4 elements
var matchScript = [4]scriptIntelligibility{
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x22e, want: 0x4f, have: 0x1d, conf: 0x2},
{lang: 0x22e, want: 0x1d, have: 0x4f, conf: 0x2},
text/language: strip unneeded struct type qualifiers. This is really just a one liner, but with lots of tables changing. Change-Id: I1c57a013a8961e7e0d09ac0fb00d0678f79794e2 Reviewed-on: https://go-review.googlesource.com/7929 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-03-23 18:47:00 +03:00
{lang: 0x0, want: 0x32, have: 0x33, conf: 0x1},
{lang: 0x0, want: 0x33, have: 0x32, conf: 0x1},
go.text/language: added tag matching algorithm. This algorithm is not based on the CLDR algorithm. It incorporates some ideas from other implementations, but it is designed from scratch. Note that the IANA registry has been updated so this CL also adds some new language codes as well as add mappings for deprecated codes. maketables.go has also been modified to work around a bug that was introduced in the latest IANA update. Note that the Match method of the Matcher interface returns an index of the original Tag along with the Tag. Certain users of Matcher, such as service like collation, need to associate data with each Tag. Package collate is updated to use the new Matcher interface. As the Matcher matches returns the index of the Tag as well, the tables can be simplified to be an array instead of a map. R=r, nigeltao, mpvl CC=golang-dev, markdavis https://golang.org/cl/13819047
2013-10-07 15:14:45 +04:00
}
go.text/cldr: Upgraded cldr, display, and language package to CLDR 25. collatation is tricky and will be handled in a different CL. display: - Minor naming updates. language: - Added support for the provisional tag for Kosovo (XK). - Hani script is no longer a special case. Removed respective code. - Likely tags now make specialize a group region to a single country. This requires a new table for group regions. - addTags now specializes region groups whenever it can make an unambiguous choice. - Matching changed format. maketables now supports both. - Added Contains method to Region for determining wheter a region is contained by another. Do later: - Cash rounding and decimals for currencies. LGTM=r R=r CC=golang-codereviews, nigeltao https://golang.org/cl/102120044
2014-06-04 12:35:00 +04:00
// Size: 128 bytes, 32 elements
var regionContainment = [32]uint32{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
0xffffffff, 0x000007a2, 0x00003044, 0x00000008,
0x403c0010, 0x00000020, 0x00000040, 0x00000080,
0x00000100, 0x00000200, 0x00000400, 0x2000384c,
0x00001000, 0x00002000, 0x00004000, 0x00008000,
0x00010000, 0x00020000, 0x00040000, 0x00080000,
0x00100000, 0x00200000, 0x01c1c000, 0x00800000,
0x01000000, 0x9e020000, 0x04000000, 0x08000000,
0x10000000, 0x20002048, 0x40000000, 0x80000000,
go.text/cldr: Upgraded cldr, display, and language package to CLDR 25. collatation is tricky and will be handled in a different CL. display: - Minor naming updates. language: - Added support for the provisional tag for Kosovo (XK). - Hani script is no longer a special case. Removed respective code. - Likely tags now make specialize a group region to a single country. This requires a new table for group regions. - addTags now specializes region groups whenever it can make an unambiguous choice. - Matching changed format. maketables now supports both. - Added Contains method to Region for determining wheter a region is contained by another. Do later: - Cash rounding and decimals for currencies. LGTM=r R=r CC=golang-codereviews, nigeltao https://golang.org/cl/102120044
2014-06-04 12:35:00 +04:00
}
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
// where each set holds all groupings that are directly connected in a region
// containment graph.
go.text/language: canonicalize deprecated regions and scripts. Analoguous to deprecated languages, deprecated regions are represented with their own internal codes and get canonicalized when necessary. The deprecated regions were previously not recognized. - refactored code for writing sorted maps. - refactored region testing code in separate components to simplify tests. - CLDR does not include the deprecated 3-letter ISO codes for all deprecated codes. We added them for completeness. - Script deprecation is hard-coded. The CLDR data only contains one remapping. maketables.go checks that this is indeed the only one. This adds about 250 bytes of data. R=r CC=golang-dev https://golang.org/cl/19850043
2013-11-08 15:52:05 +04:00
// Size: 355 bytes, 355 elements
var regionInclusion = [355]uint8{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 0 - 3F
0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x20,
0x21, 0x22, 0x23, 0x24, 0x25, 0x25, 0x22, 0x23,
0x25, 0x26, 0x21, 0x27, 0x28, 0x29, 0x2a, 0x25,
0x2b, 0x23, 0x22, 0x25, 0x24, 0x29, 0x2c, 0x2d,
0x23, 0x2e, 0x2c, 0x25, 0x2f, 0x30, 0x27, 0x25,
// Entry 40 - 7F
0x27, 0x25, 0x24, 0x30, 0x21, 0x31, 0x32, 0x33,
0x2f, 0x21, 0x26, 0x26, 0x26, 0x34, 0x2c, 0x28,
0x27, 0x26, 0x35, 0x27, 0x21, 0x33, 0x22, 0x20,
0x25, 0x2c, 0x25, 0x21, 0x36, 0x2d, 0x34, 0x29,
0x21, 0x2e, 0x37, 0x25, 0x25, 0x20, 0x38, 0x38,
0x27, 0x37, 0x38, 0x38, 0x2e, 0x39, 0x2e, 0x1f,
0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29, 0x34,
0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c, 0x22,
// Entry 80 - BF
0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21, 0x33,
0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39, 0x25,
0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b, 0x24,
0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25, 0x23,
0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e, 0x25,
0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23, 0x25,
0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37, 0x38,
0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b, 0x20,
// Entry C0 - FF
0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25, 0x2c,
0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30, 0x2e,
0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33, 0x29,
0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a, 0x23,
0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24, 0x2d,
0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b, 0x27,
0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20, 0x20,
0x20, 0x20, 0x3d, 0x20, 0x20, 0x20, 0x20, 0x20,
// Entry 100 - 13F
0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23, 0x3a,
0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b, 0x2d,
0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x38, 0x26, 0x32,
0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26, 0x21,
0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38, 0x28,
0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32, 0x2e,
0x20, 0x21, 0x2f, 0x27, 0x3c, 0x22, 0x25, 0x20,
0x27, 0x25, 0x25, 0x30, 0x3a, 0x28, 0x20, 0x28,
// Entry 140 - 17F
0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
0x20, 0x20, 0x22, 0x20, 0x20, 0x20, 0x20, 0x20,
0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20,
0x20, 0x20, 0x23, 0x23, 0x2e, 0x22, 0x31, 0x2e,
0x26, 0x2e, 0x20,
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
}
// regionInclusionBits is an array of bit vectors where every vector represents
// a set of region groupings. These sets are used to compute the distance
go.text/language: renaming of locale package: - renamed package locale to language - renamed type ID to Tag (language.Tag) - renamed type Language to Base (language.Base) - deleting locale package - changed occurences of "locale identifier" in comments to "language tag". - renamed method variable names from id or loc to t when the receiver type is Tag. R=r, nigeltao CC=golang-dev https://golang.org/cl/13468043
2013-09-05 13:16:24 +04:00
// between two regions for the purpose of language matching.
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
// Size: 300 bytes, 75 elements
var regionInclusionBits = [75]uint32{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 0 - 1F
0x02400813, 0x000007a3, 0x00003844, 0x20000808,
0x403c0011, 0x00000022, 0x20000844, 0x00000082,
0x00000102, 0x00000202, 0x00000402, 0x2000384d,
0x00001804, 0x20002804, 0x00404000, 0x00408000,
0x00410000, 0x02020000, 0x00040010, 0x00080010,
0x00100010, 0x00200010, 0x01c1c001, 0x00c00000,
0x01400000, 0x9e020001, 0x06000000, 0x0a000000,
0x12000000, 0x20002848, 0x40000010, 0x82000000,
// Entry 20 - 3F
0x00000001, 0x40000000, 0x00020000, 0x01000000,
0x00008000, 0x00002000, 0x00000200, 0x00000008,
0x00200000, 0x90000000, 0x00040000, 0x08000000,
0x00000020, 0x84000000, 0x00000080, 0x00001000,
0x00010000, 0x00000400, 0x04000000, 0x00000040,
0x10000000, 0x00004000, 0x81000000, 0x88000000,
0x00000100, 0x80020000, 0x00080000, 0x00100000,
0x00800000, 0x02000000, 0xffffffff, 0x02400fb3,
// Entry 40 - 5F
0x427c0813, 0x2240385f, 0x03c1c813, 0x9e420813,
0x92000000, 0x86000000, 0x83400000, 0x8a000000,
0x82020000, 0x9fc3c001, 0x9fc3c813,
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
}
// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
// all groups that are reachable from the groups set in the respective entry.
// Size: 75 bytes, 75 elements
var regionInclusionNext = [75]uint8{
gen: factored out generic slice generation. Semantics of when to use arrays or slices is preserved. Changed type of M49 codes to int to ensure they will be printed in decimal format, instead of hex. Change-Id: Ic4f3b5b4a9a89eb3c3730a65ee4bac9810d0c3ae Reviewed-on: https://go-review.googlesource.com/13856 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-08-24 17:28:21 +03:00
// Entry 0 - 3F
0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
0x16, 0x43, 0x19, 0x19, 0x19, 0x0b, 0x04, 0x19,
0x00, 0x1e, 0x11, 0x18, 0x0f, 0x0d, 0x09, 0x03,
0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, 0x0c,
0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, 0x47,
0x08, 0x48, 0x13, 0x14, 0x17, 0x19, 0x3e, 0x3e,
// Entry 40 - 7F
0x3e, 0x3e, 0x3e, 0x3e, 0x19, 0x19, 0x49, 0x19,
0x19, 0x4a, 0x3e,
go.text/locale: moved package from go.exp. R=r CC=golang-dev https://golang.org/cl/9893043
2013-05-31 16:31:13 +04:00
}
go.text/language: added Parent() method that returns the CLDR parent of a tag. Also added tie-breaker rule to Matcher to prefer matches for which there is a parent relation over those where this is not the case. Note that this is a low-priority rule as the region distance is a better measure (close regions are likely to share the same parent; this is not true for English, but this is already special-cased in a different manner). Also script and region equality are stronger measures than the parent relationship. The Parent relationship may change between different versions of CLDR (albeit usually only slightly). Added a Version constant to identify CLDR version on which the package is based. LGTM=r R=r CC=golang-codereviews, markdavis https://golang.org/cl/74210044
2014-03-12 10:51:42 +04:00
type parentRel struct {
lang uint16
script uint8
maxScript uint8
toRegion uint16
fromRegion []uint16
}
text: upgrade to CLDR 27.0.1 - CLDR now sports (optional) subversions. - Added var for the common SerbianLatin locale. - Allow for UNICODE_VERSION and CLDR_VERSION in internal/gen, as these values cannot be passed on the command line to go generate. Note that the display package simplified and reduced in size. This is a consequence of that latest version of CLDR reducing the complexity of the language hierarchy and streamlining some of the differences between languages. Change-Id: I086679a73815a7bb0aca099ad73ad43994b57633 Reviewed-on: https://go-review.googlesource.com/9625 Reviewed-by: Nigel Tao <nigeltao@golang.org>
2015-05-04 16:11:47 +03:00
// Size: 352 bytes, 4 elements
var parents = [4]parentRel{
{lang: 0x97, script: 0x0, maxScript: 0x4f, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x60, 0x63, 0x6c, 0x71, 0x72, 0x73, 0x79, 0x7a, 0x7d, 0x7e, 0x7f, 0x81, 0x8a, 0x8b, 0x94, 0x96, 0x97, 0x98, 0x9d, 0x9e, 0xa2, 0xa5, 0xa7, 0xab, 0xaf, 0xb2, 0xb3, 0xbd, 0xc4, 0xc8, 0xc9, 0xca, 0xcc, 0xce, 0xd0, 0xd3, 0xd4, 0xdb, 0xdd, 0xde, 0xe4, 0xe5, 0xe6, 0xe9, 0xee, 0x105, 0x107, 0x108, 0x109, 0x10b, 0x10c, 0x110, 0x115, 0x119, 0x11b, 0x11d, 0x123, 0x127, 0x12a, 0x12b, 0x12d, 0x12f, 0x136, 0x139, 0x13c, 0x13f, 0x15e, 0x15f, 0x161}},
{lang: 0x99, script: 0x0, maxScript: 0x4f, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x87, 0x8d, 0xcd, 0xd6, 0xe0, 0xe2, 0xea, 0xef, 0x118, 0x132, 0x133, 0x138}},
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
{lang: 0x1e4, script: 0x0, maxScript: 0x4f, toRegion: 0xec, fromRegion: []uint16{0x29, 0x59, 0x89, 0xc4, 0xcf, 0x116, 0x124}},
{lang: 0x2b2, script: 0x33, maxScript: 0x33, toRegion: 0x8b, fromRegion: []uint16{0xc4}},
go.text/language: added Parent() method that returns the CLDR parent of a tag. Also added tie-breaker rule to Matcher to prefer matches for which there is a parent relation over those where this is not the case. Note that this is a low-priority rule as the region distance is a better measure (close regions are likely to share the same parent; this is not true for English, but this is already special-cased in a different manner). Also script and region equality are stronger measures than the parent relationship. The Parent relationship may change between different versions of CLDR (albeit usually only slightly). Added a Version constant to identify CLDR version on which the package is based. LGTM=r R=r CC=golang-codereviews, markdavis https://golang.org/cl/74210044
2014-03-12 10:51:42 +04:00
}
language: add all languages with data in compact set maketables assigns a low code to languages that are frequent. Include all languages for which CLDR defines data in this set. This guarantees there is a compact index for all languages references in gen_index.go. This, in turn, can be used to optimize CompactIndex, which has some issues (explained in later CL). This CL also includes the addition of CLDRVersion and deprecation of Version. This is to make it consistent with other packages. (Sorry, thought I did excluded it from staging) Change-Id: Ia92e8c663fd4641976268c763645bcea2d1679a6 Reviewed-on: https://go-review.googlesource.com/16624 Reviewed-by: Hyang-Ah Hana Kim <hyangah@gmail.com>
2015-11-04 21:45:53 +03:00
// Total table size 20964 bytes (20KiB); checksum: 9504E399